BYKdb

Annotate results for A0A087B589

A0A087B589 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087B589
DOMAINtad1/139MTFSDLLAIIRKHVITIAITFVVTVTAVCAFTAVSPVKYTTTTQLFATYNDASGSQANMS
EQNNGSSYIMSQIKSYPALTATQTVLQPVIEELDLNTSASTLGETISVTNPDNTAFVNIS
VTGTDPTQTTDIANAVARS
DOMAINcd272/460TSTGASEGKTTTSVNVAAALAENGAKVLLIDADLRSPSVAKKLDIDGSAGLAHVLSGQAS
VKDVVQRYWKGNLHIMPAGPKPPNASTLLNSPVMVELLNNAMQQYDYVIIDTAPMVVAND
AIIFVRRGGSLIMVCRRDRTLKHDLREINEELTTLDLSVTGVVFNCAKDNKKGSGYGNYY
YYYSSNDSD
SITEWalker A279/281GKT
SITEWalker A'299/306LLIDADLR
SITEWalker B379/385VIIDTAP
SITE-376/-378YDY
SITEY Cluster447/454YGNYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTFSDLLAIIRKHVITIAITFVVTVTAVCAFTAVSPVKYTTTTQLFATYNDASGSQANMSEQNNGSSYIMSQIKSYPALT
MTFSDLLAIIRKHVITIAITFVVTVTAVCAFTAVSPVKYTTTTQLFATYNDASGSQANMSEQNNGSSYIMSQIKSYPALT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATQTVLQPVIEELDLNTSASTLGETISVTNPDNTAFVNISVTGTDPTQTTDIANAVARSLSNVVEKSLYATGSRSAIKLS
ATQTVLQPVIEELDLNTSASTLGETISVTNPDNTAFVNISVTGTDPTQTTDIANAVARS                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVQPAVRPTAPSSPKWKLNVLVGIVGGLVLGVFAALLKDVLSKKIEDEDELGEYLSAPIVGRIPEDELLNETSPAVICQP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSPIAEDYRRIRTNLSFIAPVDDTHCRLIITTSTGASEGKTTTSVNVAAALAENGAKVLLIDADLRSPSVAKKLDIDGSA
                               TSTGASEGKTTTSVNVAAALAENGAKVLLIDADLRSPSVAKKLDIDGSA
                                      GKT                 LLIDADLR              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLAHVLSGQASVKDVVQRYWKGNLHIMPAGPKPPNASTLLNSPVMVELLNNAMQQYDYVIIDTAPMVVANDAIIFVRRGG
GLAHVLSGQASVKDVVQRYWKGNLHIMPAGPKPPNASTLLNSPVMVELLNNAMQQYDYVIIDTAPMVVANDAIIFVRRGG
                                                          VIIDTAP               
       410       420       430       440       450       460       470    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
SLIMVCRRDRTLKHDLREINEELTTLDLSVTGVVFNCAKDNKKGSGYGNYYYYYSSNDSDTDKKKGHRLRQRKK
SLIMVCRRDRTLKHDLREINEELTTLDLSVTGVVFNCAKDNKKGSGYGNYYYYYSSNDSD              
                                              YGNYYYYY                    
© 1998-2019