BYKdb

Annotate results for A0A087BBC7

A0A087BBC7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087BBC7
DOMAINtad9/149NDLTFIDLFHIVLKHLITVVIGFIVVFGLSCVYLLVKTPEYTATAQAFTTYSDTSNVNEN
YSSLGSAASYISTQVKSYPTLITTDVVLQPVIDQMHLDESIATLAKTITAVNPTNTAFIN
ISASSEDPHEAAKIANAVTDS
DOMAINcd282/470SAVGANEGKTTTAVNVATALAETGSAVLLIDADLRNPSVAKKLDIDGSAGLAHVLSGQAS
VKDVVQRFWKANLHIMPAGPKPPNAAQLLNSPVMSELINNALHQYDYVIIDTAPLVVAND
GALFAKQGGGLVMVSRRGVTLKKQLSETAAELANLHVDVTGFVFNGAKLDKKLAGSSYYY
YTSSSDSQS
SITEWalker A289/291GKT
SITEWalker A'309/316LLIDADLR
SITEWalker B389/395VIIDTAP
SITE-386/-388YDY
SITEY Cluster459/462YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVGRDNHHNDLTFIDLFHIVLKHLITVVIGFIVVFGLSCVYLLVKTPEYTATAQAFTTYSDTSNVNENYSSLGSAASYIS
        NDLTFIDLFHIVLKHLITVVIGFIVVFGLSCVYLLVKTPEYTATAQAFTTYSDTSNVNENYSSLGSAASYIS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQVKSYPTLITTDVVLQPVIDQMHLDESIATLAKTITAVNPTNTAFINISASSEDPHEAAKIANAVTDSFQNVVQSSLYM
TQVKSYPTLITTDVVLQPVIDQMHLDESIATLAKTITAVNPTNTAFINISASSEDPHEAAKIANAVTDS           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNKQSPVKITVVQKAMVPESPSAPKTPLVLLIGIVGGLIVGIIAALLKDVLSRKIQDDSELTTYINAPTLGRIPEDEAVN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNTSVIISEPGSSVAEDYRRICTNLSFIAPISGTNSRLVVVSAVGANEGKTTTAVNVATALAETGSAVLLIDADLRNPSV
                                         SAVGANEGKTTTAVNVATALAETGSAVLLIDADLRNPSV
                                                GKT                 LLIDADLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKKLDIDGSAGLAHVLSGQASVKDVVQRFWKANLHIMPAGPKPPNAAQLLNSPVMSELINNALHQYDYVIIDTAPLVVAN
AKKLDIDGSAGLAHVLSGQASVKDVVQRFWKANLHIMPAGPKPPNAAQLLNSPVMSELINNALHQYDYVIIDTAPLVVAN
                                                                    VIIDTAP     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGALFAKQGGGLVMVSRRGVTLKKQLSETAAELANLHVDVTGFVFNGAKLDKKLAGSSYYYYTSSSDSQSKERHSSHSKD
DGALFAKQGGGLVMVSRRGVTLKKQLSETAAELANLHVDVTGFVFNGAKLDKKLAGSSYYYYTSSSDSQS          
                                                          YYYY                  
  
..
KH


© 1998-2019