BYKdb

Annotate results for A0A087BEI6

A0A087BEI6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087BEI6
DOMAINtad20/162KVYTFADLLATIRKHLIAALVACAVVIACVGAYVFLAPPEYTSTAQVIATFNAAQENGES
TDISQQNTGGTYISSQIKSYPTLTTTEKVLSPVISKLGLNESVSELAKQLVVTNPSNTAF
VNISAKSGDAQRSADIANAVAES
DOMAINcd297/485SSTSPSEGKTTTVINVAAVLAENGAKVLLVDADLRHPSVAHHLGIEGSVGLAHVLSGQMS
PVDVVQSYWKPNLHILPAGKRPANASLLLNSDMMKMLIEQALMQYDYVLIDTAPLAVSND
GIVFGSWAKGVVLVAANGICRKKDLEESMDALRTAKVPVLGFVFNFANPKKEHKNAYYYY
YEDGARRST
SITEWalker A304/306GKT
SITEWalker A'324/331LLVDADLR
SITEWalker B404/410VLIDTAP
SITE-401/-403YDY
SITEY Cluster473/477YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSEEMTEGQPSSSDNQMRKVYTFADLLATIRKHLIAALVACAVVIACVGAYVFLAPPEYTSTAQVIATFNAAQENGEST
                   KVYTFADLLATIRKHLIAALVACAVVIACVGAYVFLAPPEYTSTAQVIATFNAAQENGEST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DISQQNTGGTYISSQIKSYPTLTTTEKVLSPVISKLGLNESVSELAKQLVVTNPSNTAFVNISAKSGDAQRSADIANAVA
DISQQNTGGTYISSQIKSYPTLTTTEKVLSPVISKLGLNESVSELAKQLVVTNPSNTAFVNISAKSGDAQRSADIANAVA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESLRTVVQQDLYGGSKGQSPIKLTVVQKATVPQSPSSPKKGLYFAIGVVLGIIVGVFAAVLKELLSTKVEETSDVRGIVK
ES                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASALGSVPKNEVLSGTRPIIITEPNGPVAEEYRRIRANIKFLQADKVPDRGQLLVISSTSPSEGKTTTVINVAAVLAENG
                                                        SSTSPSEGKTTTVINVAAVLAENG
                                                               GKT              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKVLLVDADLRHPSVAHHLGIEGSVGLAHVLSGQMSPVDVVQSYWKPNLHILPAGKRPANASLLLNSDMMKMLIEQALMQ
AKVLLVDADLRHPSVAHHLGIEGSVGLAHVLSGQMSPVDVVQSYWKPNLHILPAGKRPANASLLLNSDMMKMLIEQALMQ
   LLVDADLR                                                                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDYVLIDTAPLAVSNDGIVFGSWAKGVVLVAANGICRKKDLEESMDALRTAKVPVLGFVFNFANPKKEHKNAYYYYYEDG
YDYVLIDTAPLAVSNDGIVFGSWAKGVVLVAANGICRKKDLEESMDALRTAKVPVLGFVFNFANPKKEHKNAYYYYYEDG
   VLIDTAP                                                              YYYYY   
       490   
....:....|...
ARRSTPRRNGRKH
ARRST        

© 1998-2019