BYKdb

Annotate results for A0A087BEY8

A0A087BEY8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087BEY8
DOMAINtad23/163DGLTLIDLFHVLFKHAITAIIGFVVVFGCACVYLLMATPQYSATTQTFTTYSDTSTADDN
YSSLGSAASYISTQVKSYPNLIKTDVVLQPVINQLHLDISVNGLAGMVTATNPSNTAFIN
ISVTSSDPQQAAQIANAVASS
DOMAINcd296/483SAVGANEGKTTTSVNLAAALAENGATVLLIDADLRHPSVANKLNIDGSVGLAHVLSGQAS
VKDVVQRYWKSNLHIMPAGPKPPNASQLINSPIMSELIEHALHQYDYVIIDTPPLVVAND
AVIFAKQGGGLVIVSRRAMTRKKELTDTANELRNLHVDVTGFVFNGAKDEKTSLYGSNYY
YYSNDSKG
SITEWalker A303/305GKT
SITEWalker A'323/330LLIDADLR
SITEWalker B403/409VIIDTPP
SITE-400/-402YDY
SITEY Cluster470/477YGSNYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASMSDEKGTYAATNANNKEQHDGLTLIDLFHVLFKHAITAIIGFVVVFGCACVYLLMATPQYSATTQTFTTYSDTSTAD
                      DGLTLIDLFHVLFKHAITAIIGFVVVFGCACVYLLMATPQYSATTQTFTTYSDTSTAD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNYSSLGSAASYISTQVKSYPNLIKTDVVLQPVINQLHLDISVNGLAGMVTATNPSNTAFINISVTSSDPQQAAQIANAV
DNYSSLGSAASYISTQVKSYPNLIKTDVVLQPVINQLHLDISVNGLAGMVTATNPSNTAFINISVTSSDPQQAAQIANAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASSFQNVVQSSLYADGKPSPVKITVVQNASVPSSPTSPKTALVLLAGIVGGLIVGIVAALLKDIFTRKIQDESELESYIN
ASS                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APVLGRIPEDEEIGKDASVIVSQPGSVAAEDYRRICTNLTFIAPVSGTNSRLIVVSAVGANEGKTTTSVNLAAALAENGA
                                                       SAVGANEGKTTTSVNLAAALAENGA
                                                              GKT               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVLLIDADLRHPSVANKLNIDGSVGLAHVLSGQASVKDVVQRYWKSNLHIMPAGPKPPNASQLINSPIMSELIEHALHQY
TVLLIDADLRHPSVANKLNIDGSVGLAHVLSGQASVKDVVQRYWKSNLHIMPAGPKPPNASQLINSPIMSELIEHALHQY
  LLIDADLR                                                                      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYVIIDTPPLVVANDAVIFAKQGGGLVIVSRRAMTRKKELTDTANELRNLHVDVTGFVFNGAKDEKTSLYGSNYYYYSND
DYVIIDTPPLVVANDAVIFAKQGGGLVIVSRRAMTRKKELTDTANELRNLHVDVTGFVFNGAKDEKTSLYGSNYYYYSND
  VIIDTPP                                                            YGSNYYYY   
       490       500  
....:....|....:....|..
SKGSGEHHHHTRKSSTSRSLKK
SKG                   

© 1998-2019