BYKdb

Annotate results for A0A087BKW6

A0A087BKW6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087BKW6
DOMAINtad37/180EGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYTLTAQKKYTATAQLFASYNNTTADALD
SSVSSQSTAGTYIATQLKSYPDLVKTEAVLQPVIDELNDNSITTDDLAAMVTATNPTDTY
MLNVSVEATSPEQSAQLANEVSQS
DOMAINcd314/503TSSMPSEGKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQAS
VKDVVQRYWKPNLHIMPAGPRIQNASVLLNSRIMHELVHQAVQQYDYVIIDTTPMSVAND
AAVFGQMGNGVVMISARGTTYKSALRGAVNELRDLDVPLLGYVFNLADEKRNRGYGNYYY
YGSYYKGEYG
SITEWalker A321/323GKT
SITEWalker A'341/348LLIDADLR
SITEWalker B421/427VIIDTTP
SITE-418/-420YDY
SITEY Cluster488/502YGNYYYYGSYYKGEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYTLTAQKKYTAT
                                    EGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYTLTAQKKYTAT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQLFASYNNTTADALDSSVSSQSTAGTYIATQLKSYPDLVKTEAVLQPVIDELNDNSITTDDLAAMVTATNPTDTYMLNV
AQLFASYNNTTADALDSSVSSQSTAGTYIATQLKSYPDLVKTEAVLQPVIDELNDNSITTDDLAAMVTATNPTDTYMLNV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVEATSPEQSAQLANEVSQSLSRVVSSELYASGKKSMVKLSVVQKAKTPTSQSSPNTKLNIAVAVVAGIVLGIFAALVRD
SVEATSPEQSAQLANEVSQS                                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLARKLQDLMDLQSIDPNGSIAGIIPKDEVLNVTKPVIVTKPDSPIAEEFRRMRTNLSFVTSKDGDKGRLIVITSSMPSE
                                                                         TSSMPSE

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMPAGPRIQNASV
GKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMPAGPRIQNASV
GKT                 LLIDADLR                                                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMISARGTTYKSALRGAVNELRDLDVPLLGYVFNLA
LLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMISARGTTYKSALRGAVNELRDLDVPLLGYVFNLA
                    VIIDTTP                                                     
       490       500       510       520 
....:....|....:....|....:....|....:....|.
DEKRNRGYGNYYYYGSYYKGEYGKEDSKKDRKRRRSHRRGK
DEKRNRGYGNYYYYGSYYKGEYG                  
       YGNYYYYGSYYKGEY                   
© 1998-2019