BYKdb

Annotate results for A0A087BSB6

A0A087BSB6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087BSB6
DOMAINtad6/146SIVTLADMWIILKKRRVTALVTAFVVFGLVVIVTFLMPPKYTATAEIFASYASKSESSQT
SADMNSGTSYLSTQIKTYPSLVKTEAILKPVISDLNLDMTVEQLADMVTATNPTNTFMVD
ISVEGGDPDQSAAIANSVANN
DOMAINcd281/469TSAEPGEGKTTVATNVAAAIAEEGKTVLLIDGDLRHPSVARALDIEGNVGLSHILSAQAT
PMDVVQPYWRPNFHILPAGRRVANASILLNSAIMLELVEQAQKQYDYVIVDMTPMSVSND
AAVLGKISDGVVMVVGREVADKRDLRSVLESLTTTKVKILGYIFNLANPKKIHSKNYYYY
AEESSTGAH
SITEWalker A288/290GKT
SITEWalker A'308/315LLIDGDLR
SITEWalker B388/394VIVDMTP
SITE-385/-387YDY
SITE-304/-306GKT
SITEY Cluster457/460YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGRNESIVTLADMWIILKKRRVTALVTAFVVFGLVVIVTFLMPPKYTATAEIFASYASKSESSQTSADMNSGTSYLSTQI
     SIVTLADMWIILKKRRVTALVTAFVVFGLVVIVTFLMPPKYTATAEIFASYASKSESSQTSADMNSGTSYLSTQI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTYPSLVKTEAILKPVISDLNLDMTVEQLADMVTATNPTNTFMVDISVEGGDPDQSAAIANSVANNLARQISSSLYSGDD
KTYPSLVKTEAILKPVISDLNLDMTVEQLADMVTATNPTNTFMVDISVEGGDPDQSAAIANSVANN              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTSPIKLSVVQPAVVPQSPSTPKIPLYLVAGLVLAVVMAVAVALIKDMVNTKIDSVDDVKEIDNGAASLGSVPKSAFMTE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAVVVSAHPASAEAEDFRRIRSNISFLTPPQAGKGHLLIFTSAEPGEGKTTVATNVAAAIAEEGKTVLLIDGDLRHPSVA
                                        TSAEPGEGKTTVATNVAAAIAEEGKTVLLIDGDLRHPSVA
                                               GKT                 LLIDGDLR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RALDIEGNVGLSHILSAQATPMDVVQPYWRPNFHILPAGRRVANASILLNSAIMLELVEQAQKQYDYVIVDMTPMSVSND
RALDIEGNVGLSHILSAQATPMDVVQPYWRPNFHILPAGRRVANASILLNSAIMLELVEQAQKQYDYVIVDMTPMSVSND
                                                                   VIVDMTP      
       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
AAVLGKISDGVVMVVGREVADKRDLRSVLESLTTTKVKILGYIFNLANPKKIHSKNYYYYAEESSTGAHHAGTAKKRNS
AAVLGKISDGVVMVVGREVADKRDLRSVLESLTTTKVKILGYIFNLANPKKIHSKNYYYYAEESSTGAH          
                                                        YYYY                   
© 1998-2019