BYKdb

Annotate results for A0A087C7D7

A0A087C7D7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087C7D7
DOMAINtad1/139MTIADLLHVLRKHVVTVVTAFVVVFLAVAAFTFLSPPKYTATAELFATYSGQSDGTQNSN
EMNSGASYLSTQIKTYPQLIKTQAILQPVIDDLSLNMSVKDLADTVTATNPTNTFMVDIA
VETGDAQQSAQIANSVSKN
DOMAINcd273/461TSTEPSEGKTTLSVNVASAIAEEGKSVLLIDGDLRHPSVARALGLEGHVGLSHILSGQAS
PREIVQQYWKPNFHILPAGKRPGNASILLNSVIMTELIDQALTQYDYVILDTAPLSVAND
AAIFGKQADGVVLVVGKGVADKKELHATVESLHTSEVPVLGFILNFADPKRINASNYYYY
EEDGKSHGK
SITEWalker A280/282GKT
SITEWalker A'300/307LLIDGDLR
SITEWalker B380/386VILDTAP
SITE-377/-379YDY
SITE-296/-298GKS
SITEY Cluster449/452YYYY
SITE-456/-458GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIADLLHVLRKHVVTVVTAFVVVFLAVAAFTFLSPPKYTATAELFATYSGQSDGTQNSNEMNSGASYLSTQIKTYPQLI
MTIADLLHVLRKHVVTVVTAFVVVFLAVAAFTFLSPPKYTATAELFATYSGQSDGTQNSNEMNSGASYLSTQIKTYPQLI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTQAILQPVIDDLSLNMSVKDLADTVTATNPTNTFMVDIAVETGDAQQSAQIANSVSKNLAKQISSSLYSNDAGKSPIQL
KTQAILQPVIDDLSLNMSVKDLADTVTATNPTNTFMVDIAVETGDAQQSAQIANSVSKN                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVVQEAQTPTAPSSPKIPLYLAAGFVLALIVAVGAALLRDVLNTRVDSLEDAKTLTDASSLGTVPRSSRMEERKPVVVAE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSSHEAEQIRRIRTNISFLSPNTNDHGHLVVITSTEPSEGKTTLSVNVASAIAEEGKSVLLIDGDLRHPSVARALGLEGH
                                TSTEPSEGKTTLSVNVASAIAEEGKSVLLIDGDLRHPSVARALGLEGH
                                       GKT                 LLIDGDLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGLSHILSGQASPREIVQQYWKPNFHILPAGKRPGNASILLNSVIMTELIDQALTQYDYVILDTAPLSVANDAAIFGKQA
VGLSHILSGQASPREIVQQYWKPNFHILPAGKRPGNASILLNSVIMTELIDQALTQYDYVILDTAPLSVANDAAIFGKQA
                                                           VILDTAP              
       410       420       430       440       450       460       470   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
DGVVLVVGKGVADKKELHATVESLHTSEVPVLGFILNFADPKRINASNYYYYEEDGKSHGKARRSARGRDKRH
DGVVLVVGKGVADKKELHATVESLHTSEVPVLGFILNFADPKRINASNYYYYEEDGKSHGK            
                                                YYYY                     
© 1998-2019