BYKdb

Annotate results for A0A087CJ39

A0A087CJ39 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087CJ39
DOMAINtad25/165SGFTVVELVSVIRKHLSIVAAGFASIIFVVAVYSLTATPRYIAASELFVSYDVSSTASQD
IASINTAGAYIATQIQTYPKLASTAAVLEPVISDLNLDTSVVDLGKSITVTNPSNTMLID
ISVETDNPAQSQKIANAVAES
DOMAINcd297/485TSTEPGEGKTTTSVNIAAAFAENGSRVLLIDADLRHPSVADKVGLEGAVGLSHVLSGQAN
VADVVQRYWKANLHVMPAGPKPPNASILLNSTTMEAMVAQALKQYDYVIIDTTPMTIAAD
AAMFGRMGNGVVMVVGRGVCDKKDLSSTLSQLKNVEVPVIGTILNYAEQSKKHHGNYYYY
DTEGKRQQR
SITEWalker A304/306GKT
SITEWalker A'324/331LLIDADLR
SITEWalker B404/410VIIDTTP
SITE-401/-403YDY
SITEY Cluster473/476YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSLGNEADSDNKARKVDTHESPRSGFTVVELVSVIRKHLSIVAAGFASIIFVVAVYSLTATPRYIAASELFVSYDVSST
                        SGFTVVELVSVIRKHLSIVAAGFASIIFVVAVYSLTATPRYIAASELFVSYDVSST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASQDIASINTAGAYIATQIQTYPKLASTAAVLEPVISDLNLDTSVVDLGKSITVTNPSNTMLIDISVETDNPAQSQKIAN
ASQDIASINTAGAYIATQIQTYPKLASTAAVLEPVISDLNLDTSVVDLGKSITVTNPSNTMLIDISVETDNPAQSQKIAN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAESLSNTVKSSLYSSSNSPVKLAVVQKATLPESPSSPNIKLNLIIGALLGLIVGVLAALVRNMMDTRLGSLRDLQSIT
AVAES                                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAPLLGSIPSNDAVKKTSSVIASAPSSLVAEEYRRVRSNLSFIAPVEGLNSRLIVVTSTEPGEGKTTTSVNIAAAFAENG
                                                        TSTEPGEGKTTTSVNIAAAFAENG
                                                               GKT              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRVLLIDADLRHPSVADKVGLEGAVGLSHVLSGQANVADVVQRYWKANLHVMPAGPKPPNASILLNSTTMEAMVAQALKQ
SRVLLIDADLRHPSVADKVGLEGAVGLSHVLSGQANVADVVQRYWKANLHVMPAGPKPPNASILLNSTTMEAMVAQALKQ
   LLIDADLR                                                                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDYVIIDTTPMTIAADAAMFGRMGNGVVMVVGRGVCDKKDLSSTLSQLKNVEVPVIGTILNYAEQSKKHHGNYYYYDTEG
YDYVIIDTTPMTIAADAAMFGRMGNGVVMVVGRGVCDKKDLSSTLSQLKNVEVPVIGTILNYAEQSKKHHGNYYYYDTEG
   VIIDTTP                                                              YYYY    
        
....:...
KRQQRHTS
KRQQR   

© 1998-2019