BYKdb

Annotate results for A0A087CP34

A0A087CP34 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087CP34
DOMAINtad10/151EGITLGELLQMIRKHIVSAIVVCVVVFAAVAAYTFLAPKKYEATAELLAMSGQGAISDNA
NASQYSSIGSYINTQIATYPQLVKTEAVLEPVIDDLGLDTTVAETAELITASNPDGTFMV
DITAETEDPALSQQLANAVADS
DOMAINcd286/473SSVSPSEGKTTTSVNVAAALAEDGAKVLLIDADLRHPSVAHHLGIEGHAGLAHVLSGQMT
PKDVVQSYWKPNFHILPAGKRPANASILLNSDTMEALIRQALTQYDYVIVDTAPMSVSND
GVVFGRLANGIVLVTGKGITEKKDLQETAETLKTASVPVLGFIFTFADPKKSHAGNYYYY
YYEDGTKR
SITEWalker A293/295GKT
SITEWalker A'313/320LLIDADLR
SITEWalker B393/399VIVDTAP
SITE-390/-392YDY
SITEY Cluster462/467YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDQNQMEQEEGITLGELLQMIRKHIVSAIVVCVVVFAAVAAYTFLAPKKYEATAELLAMSGQGAISDNANASQYSSIGSY
         EGITLGELLQMIRKHIVSAIVVCVVVFAAVAAYTFLAPKKYEATAELLAMSGQGAISDNANASQYSSIGSY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INTQIATYPQLVKTEAVLEPVIDDLGLDTTVAETAELITASNPDGTFMVDITAETEDPALSQQLANAVADSLSEQVSTSM
INTQIATYPQLVKTEAVLEPVIDDLGLDTTVAETAELITASNPDGTFMVDITAETEDPALSQQLANAVADS         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTVSEDQAPVSLSVVQQAALPEGQSSPNVPLYLAAGLVVGIILGIGFAIVREMLNTRIDTTSDVRGILGSSAIGSIPDDQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILLEQQPVVIAQPGGPLAEEYRRVRTNISFLKTDRVAGEGQLIVISSVSPSEGKTTTSVNVAAALAEDGAKVLLIDADLR
                                             SSVSPSEGKTTTSVNVAAALAEDGAKVLLIDADLR
                                                    GKT                 LLIDADLR
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPSVAHHLGIEGHAGLAHVLSGQMTPKDVVQSYWKPNFHILPAGKRPANASILLNSDTMEALIRQALTQYDYVIVDTAPM
HPSVAHHLGIEGHAGLAHVLSGQMTPKDVVQSYWKPNFHILPAGKRPANASILLNSDTMEALIRQALTQYDYVIVDTAPM
                                                                        VIVDTAP 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVSNDGVVFGRLANGIVLVTGKGITEKKDLQETAETLKTASVPVLGFIFTFADPKKSHAGNYYYYYYEDGTKRSNTKRKG
SVSNDGVVFGRLANGIVLVTGKGITEKKDLQETAETLKTASVPVLGFIFTFADPKKSHAGNYYYYYYEDGTKR       
                                                             YYYYYY             
        
....:...
GKNNKRRQ


© 1998-2019