BYKdb

Annotate results for A0A087CXM2

A0A087CXM2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087CXM2
DOMAINtad24/167SGITIMDLMRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTSTAQMFATFNTSTADATQ
DNNYGSINSAGTYIANQIKSYPTLATTESVLQPVIDQLGLDTSVSSLAGELTVTNPTDTA
FVNIQVEDKDPKQAAAIANAVAKS
DOMAINcd300/487SSTSPSEGKTTSSVNLAVALAENGAKVLLIDADLRHPSVADRLGLEGNAGLTHVLSGQAA
VKDVVQRYWKPNLHIMPAGPKPPNASALLNSAIMKELIKQALTQYDYVLVDTSPLVVAND
AFVFGAMGNGIVIVSGRDVTDKRDLREIAAQLDNLNLSVSGFIFNYAKDSKKVAYKGNYY
YYDDDAST
SITEWalker A307/309GKT
SITEWalker A'327/334LLIDADLR
SITEWalker B407/413VLVDTSP
SITE-404/-406YDY
SITEY Cluster474/481YKGNYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVSANNEQQQNQNAADTAVAQAESGITIMDLMRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTSTAQMFATFNTSTAD
                       SGITIMDLMRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTSTAQMFATFNTSTAD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATQDNNYGSINSAGTYIANQIKSYPTLATTESVLQPVIDQLGLDTSVSSLAGELTVTNPTDTAFVNIQVEDKDPKQAAAI
ATQDNNYGSINSAGTYIANQIKSYPTLATTESVLQPVIDQLGLDTSVSSLAGELTVTNPTDTAFVNIQVEDKDPKQAAAI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANAVAKSMKTVVEDSLYSSDSKSPVTLSVVQQAQVPAGPSSPKIPMNMAIGVLGGLILGIIVALVKDLFSTRIEEAFELQ
ANAVAKS                                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYIDAPIMGRIPEDDLLKGDVPVIISKPSSPIAEEYRRIRTNLSFTAPVEGMNARLIVLSSTSPSEGKTTSSVNLAVALA
                                                           SSTSPSEGKTTSSVNLAVALA
                                                                  GKT           
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENGAKVLLIDADLRHPSVADRLGLEGNAGLTHVLSGQAAVKDVVQRYWKPNLHIMPAGPKPPNASALLNSAIMKELIKQA
ENGAKVLLIDADLRHPSVADRLGLEGNAGLTHVLSGQAAVKDVVQRYWKPNLHIMPAGPKPPNASALLNSAIMKELIKQA
      LLIDADLR                                                                  
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTQYDYVLVDTSPLVVANDAFVFGAMGNGIVIVSGRDVTDKRDLREIAAQLDNLNLSVSGFIFNYAKDSKKVAYKGNYYY
LTQYDYVLVDTSPLVVANDAFVFGAMGNGIVIVSGRDVTDKRDLREIAAQLDNLNLSVSGFIFNYAKDSKKVAYKGNYYY
      VLVDTSP                                                            YKGNYYY
       490       500       510  
....:....|....:....|....:....|..
YDDDASTDGKKGKAGGQRPKQRSTARRAAVKR
YDDDAST                         
Y                               
© 1998-2019