BYKdb

Annotate results for A0A087D5G1

A0A087D5G1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087D5G1
DOMAINtad29/168DGITLMDLLKIIRKHLVATIVAFVVVVAGVSAYTFLAPPKYTATAQTMATYNASGDGESI
SQQSTGGTYISNQITSYPTLATTSKVLKPVIEELGLDKTVADLADQVTVTNPTNTAFVNI
SVVDGDPQQAADIANAVAGS
DOMAINcd301/490TSAQPSEGKTTTSINTAAALAEDGAKVLLVDADLRHPSVAHHLGIEGNAGLAHVLSGQMR
PKDVVQSYWRPNLHILPAGKRPANAGVLLGSETMKLMVEQALTQYDYVIIDTAPLNVAND
GAVFGRWAKGIVLVAGRGVCEKKALQEGFDSLVDANVPVLGFIFNYADPKKMHNQSNYYY
YYEDGAPRRK
SITEWalker A308/310GKT
SITEWalker A'328/335LLVDADLR
SITEWalker B408/414VIIDTAP
SITE-405/-407YDY
SITEY Cluster478/482YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKNSVASVENANAQQAVAPQGVVEETDDGITLMDLLKIIRKHLVATIVAFVVVVAGVSAYTFLAPPKYTATAQTMATYN
                            DGITLMDLLKIIRKHLVATIVAFVVVVAGVSAYTFLAPPKYTATAQTMATYN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASGDGESISQQSTGGTYISNQITSYPTLATTSKVLKPVIEELGLDKTVADLADQVTVTNPTNTAFVNISVVDGDPQQAAD
ASGDGESISQQSTGGTYISNQITSYPTLATTSKVLKPVIEELGLDKTVADLADQVTVTNPTNTAFVNISVVDGDPQQAAD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IANAVAGSLKDVIEKDLYSGTESPVRVSIVQKAQTPQSKSSPKTALYLAVGVVLGIIIGVFTALIKDLLNTKVEETSEVR
IANAVAGS                                                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVVHASTLGSVPTDSSLDEKRPVVVSQPNGAIAEEYRRIHTNIEFLQTDRTEGVGQLIVITSAQPSEGKTTTSINTAAAL
                                                            TSAQPSEGKTTTSINTAAAL
                                                                   GKT          
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEDGAKVLLVDADLRHPSVAHHLGIEGNAGLAHVLSGQMRPKDVVQSYWRPNLHILPAGKRPANAGVLLGSETMKLMVEQ
AEDGAKVLLVDADLRHPSVAHHLGIEGNAGLAHVLSGQMRPKDVVQSYWRPNLHILPAGKRPANAGVLLGSETMKLMVEQ
       LLVDADLR                                                                 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALTQYDYVIIDTAPLNVANDGAVFGRWAKGIVLVAGRGVCEKKALQEGFDSLVDANVPVLGFIFNYADPKKMHNQSNYYY
ALTQYDYVIIDTAPLNVANDGAVFGRWAKGIVLVAGRGVCEKKALQEGFDSLVDANVPVLGFIFNYADPKKMHNQSNYYY
       VIIDTAP                                                               YYY
       490        
....:....|....:...
YYEDGAPRRKRGGHNKKH
YYEDGAPRRK        
YY                
© 1998-2019