BYKdb

Annotate results for A0A087D8L2

A0A087D8L2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087D8L2
DOMAINtad1/78MSSGASYLSTQIKTYPELVKTESVLDPVIDELGLDMTPEALAEAVTATNPTSTYMIDISA
EVGDPQQAADIANSVAKN
DOMAINcd212/400TSTDPSEGKTTVSANVAVALAEEGKSVLLVDADLRHPSVAPKLGIEGHVGLSHVLSGQAS
PKDVIQKYWKPNLHVLPAGKRPANASILLNSDIMRELIDQALTQYDYVIIDTTPLSVAGD
ATLFGRMAGGLVLVTGKGVVEKKELQSTVESLKTAEVPILGFIFNFADPKKIHSGNYYYY
YGEENNKKG
SITEWalker A219/221GKT
SITEWalker A'239/246LLVDADLR
SITEWalker B319/325VIIDTTP
SITE-316/-318YDY
SITE-235/-237GKS
SITEY Cluster388/392YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSGASYLSTQIKTYPELVKTESVLDPVIDELGLDMTPEALAEAVTATNPTSTYMIDISAEVGDPQQAADIANSVAKNLS
MSSGASYLSTQIKTYPELVKTESVLDPVIDELGLDMTPEALAEAVTATNPTSTYMIDISAEVGDPQQAADIANSVAKN  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQISSDLYTNGQGKSPISLSVVQKAKVPTSKSSPKVPMFLAAGFVLGVIIAIGVALLKDILNTKVDSSDDVRELTRASSL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSVPLSDTLDDNRPIVVAQPASSEAEEFRRVRTNLSFLATTPGQHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLL
                                                   TSTDPSEGKTTVSANVAVALAEEGKSVLL
                                                          GKT                 LL
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRHPSVAPKLGIEGHVGLSHVLSGQASPKDVIQKYWKPNLHVLPAGKRPANASILLNSDIMRELIDQALTQYDYVI
VDADLRHPSVAPKLGIEGHVGLSHVLSGQASPKDVIQKYWKPNLHVLPAGKRPANASILLNSDIMRELIDQALTQYDYVI
VDADLR                                                                        VI
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTTPLSVAGDATLFGRMAGGLVLVTGKGVVEKKELQSTVESLKTAEVPILGFIFNFADPKKIHSGNYYYYYGEENNKKG
IDTTPLSVAGDATLFGRMAGGLVLVTGKGVVEKKELQSTVESLKTAEVPILGFIFNFADPKKIHSGNYYYYYGEENNKKG
IDTTP                                                              YYYYY        
       410 
....:....|.
GKNRRNRKKRR


© 1998-2019