BYKdb

Annotate results for A0A087D923

A0A087D923 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087D923
DOMAINtad24/166NGITIMDLLRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTATSQVFATFSASDSTSSQ
GNFNDINNAGSYISNQIKSYPTLATTESVLQPVIDQLGLSSTVSQLAGQLTVTNPTDTAF
VNISVEDTNPKEAADIANAVAKS
DOMAINcd299/488SSTGPSEGKTTSAVNTAVALAENGAKVLLVDADLRHPSVANRLGLEGNAGLTHVLSGQAS
VKDVVQRYWKPNLHIMPAGPKPPNASALLNSPVMKELLKQALAQYDYVLVDTSPLVVAND
AYVFGAMGNGIVIVSGRDVTDKRDLRDIAAQLDTLNISVNGFIFNYAKDSKKDYSSKYNN
YYYYDDDSNS
SITEWalker A306/308GKT
SITEWalker A'326/333LLVDADLR
SITEWalker B406/412VLVDTSP
SITE-403/-405YDY
SITEY Cluster472/482YSSKYNNYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVSAENNEQQNQSVADSAAAQAENGITIMDLLRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTATSQVFATFSASDST
                       NGITIMDLLRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTATSQVFATFSASDST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSQGNFNDINNAGSYISNQIKSYPTLATTESVLQPVIDQLGLSSTVSQLAGQLTVTNPTDTAFVNISVEDTNPKEAADIA
SSQGNFNDINNAGSYISNQIKSYPTLATTESVLQPVIDQLGLSSTVSQLAGQLTVTNPTDTAFVNISVEDTNPKEAADIA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAVAKSMKTVVEDSLYSSGNKSPVTLSVVQQAQEPSGPSSPKITLNMAIGIVGGLILGIIVALLKDLFSTRIEEAFELQE
NAVAKS                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIDAPIMGRIPEDDLLKGEVPVIIAKPSSPIAEEYRRVRTNLSFTAPVEGMSSRLIVMSSTGPSEGKTTSAVNTAVALAE
                                                          SSTGPSEGKTTSAVNTAVALAE
                                                                 GKT            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGAKVLLVDADLRHPSVANRLGLEGNAGLTHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSPVMKELLKQAL
NGAKVLLVDADLRHPSVANRLGLEGNAGLTHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSPVMKELLKQAL
     LLVDADLR                                                                   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQYDYVLVDTSPLVVANDAYVFGAMGNGIVIVSGRDVTDKRDLRDIAAQLDTLNISVNGFIFNYAKDSKKDYSSKYNNYY
AQYDYVLVDTSPLVVANDAYVFGAMGNGIVIVSGRDVTDKRDLRDIAAQLDTLNISVNGFIFNYAKDSKKDYSSKYNNYY
     VLVDTSP                                                           YSSKYNNYY
       490       500       510 
....:....|....:....|....:....|.
YYDDDSNSGNKNSRNKKRPKRSAPRRAAVKR
YYDDDSNS                       
YY                             
© 1998-2019