BYKdb

Annotate results for A0A087DKU0

A0A087DKU0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087DKU0
DOMAINtad1/155MTVADILEALKKHLIVELAVLLVVLAGGYAYVSRQTPQYTATTQMFASVNHSAIYGSSDA
SAGEPSGDDSTKSSPTADASGDTSYISGQVGALPTLVTTPAVLQPVIDDLGLDTTVDALG
TKITVSTQTTYFVNVSVVDTNPKRAANIANAVSRS
DOMAINcd291/481SSAGQHEGKTTVAVNLAAALAEKGEKVLLIDTDLRRPSVAKALNINGKVGLSHLLAGQVG
SKDAIQQYWKPNFHVLPAGDQTTNPSILINSHAMQELLKQVASTYDHVIIDTTPMRVAND
AAVFAKEGARLILVASQGVTVKKQLRDTMQEFEMIGVAPVGTVFNNDHVKRGKNSYYYYG
DYAGKGKSSRA
SITE-476/-478GKS
SITEWalker A'318/325LLIDTDLR
SITEWalker B398/404VIIDTTP
SITEY Cluster466/472YYYYGDY
SITEWalker A298/300GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTVADILEALKKHLIVELAVLLVVLAGGYAYVSRQTPQYTATTQMFASVNHSAIYGSSDASAGEPSGDDSTKSSPTADAS
MTVADILEALKKHLIVELAVLLVVLAGGYAYVSRQTPQYTATTQMFASVNHSAIYGSSDASAGEPSGDDSTKSSPTADAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDTSYISGQVGALPTLVTTPAVLQPVIDDLGLDTTVDALGTKITVSTQTTYFVNVSVVDTNPKRAANIANAVSRSLKKQI
GDTSYISGQVGALPTLVTTPAVLQPVIDDLGLDTTVDALGTKITVSTQTTYFVNVSVVDTNPKRAANIANAVSRS     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SADSYASEKTYVLSLLNLAVVRQAEVPKTPSSPNVKSFMFKMTLAGIVAAVCVALIIEAADKRLRQIADLQRLADAPTLG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLKDDAFQASAPVVVSAPSGSAAESIRRLALNLMFIAPDRTEQSNVIVISSAGQHEGKTTVAVNLAAALAEKGEKVLLI
                                                  SSAGQHEGKTTVAVNLAAALAEKGEKVLLI
                                                         GKT                 LLI
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTDLRRPSVAKALNINGKVGLSHLLAGQVGSKDAIQQYWKPNFHVLPAGDQTTNPSILINSHAMQELLKQVASTYDHVII
DTDLRRPSVAKALNINGKVGLSHLLAGQVGSKDAIQQYWKPNFHVLPAGDQTTNPSILINSHAMQELLKQVASTYDHVII
DTDLR                                                                        VII
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTTPMRVANDAAVFAKEGARLILVASQGVTVKKQLRDTMQEFEMIGVAPVGTVFNNDHVKRGKNSYYYYGDYAGKGKSSR
DTTPMRVANDAAVFAKEGARLILVASQGVTVKKQLRDTMQEFEMIGVAPVGTVFNNDHVKRGKNSYYYYGDYAGKGKSSR
DTTP                                                             YYYYGDY        
       490    
....:....|....
ARKGRRSATDGKQA
A             

© 1998-2019