BYKdb

Annotate results for A0A087E8V5

A0A087E8V5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087E8V5
DOMAINtad1/133MQIIRKRIVTVIVTFCIVFAAVAAFTFLSPTKYTATAELFATYTGQSDAQQNSSEMSSGA
SYLSTQIKTYPQLIKTQAVLQPVISDLNLDMKASDLAGMVTATNPSNTFMVDVSVEASSA
KQSADIANSVANN
DOMAINcd267/455TSTEPLEGKTTVSVNTAAAIAEDGKTVLLIDADLRHPSVAKSLGIEGHVGLSHILSGQAS
PRDIVQKYWKPNFHVLPAGKRSGNASILLNSQVMHEMVEQALQQYDYVILDTAPMSVSND
AAVFGRLADGVVMVVGKGVAEKKELESTVQALSTAEVPVLGYVFNFADPKKIHSKNYYYY
GESAPKGDK
SITEWalker A274/276GKT
SITEWalker A'294/301LLIDADLR
SITEWalker B374/380VILDTAP
SITE-371/-373YDY
SITE-290/-292GKT
SITEY Cluster443/446YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQIIRKRIVTVIVTFCIVFAAVAAFTFLSPTKYTATAELFATYTGQSDAQQNSSEMSSGASYLSTQIKTYPQLIKTQAVL
MQIIRKRIVTVIVTFCIVFAAVAAFTFLSPTKYTATAELFATYTGQSDAQQNSSEMSSGASYLSTQIKTYPQLIKTQAVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPVISDLNLDMKASDLAGMVTATNPSNTFMVDVSVEASSAKQSADIANSVANNLSEQISSALYTDGTNKSPIQLSVVQKA
QPVISDLNLDMKASDLAGMVTATNPSNTFMVDVSVEASSAKQSADIANSVANN                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPPEAPSSPKTVLYLAAGVVLGIIAAIGAALLKDMINTKVDDTDEAKELTQTSSLGTVPRSEIFDDTRPAVVGNTGSREA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEFRRIRTNIAFLNPDARDHGHLLVITSTEPLEGKTTVSVNTAAAIAEDGKTVLLIDADLRHPSVAKSLGIEGHVGLSHI
                          TSTEPLEGKTTVSVNTAAAIAEDGKTVLLIDADLRHPSVAKSLGIEGHVGLSHI
                                 GKT                 LLIDADLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSGQASPRDIVQKYWKPNFHVLPAGKRSGNASILLNSQVMHEMVEQALQQYDYVILDTAPMSVSNDAAVFGRLADGVVMV
LSGQASPRDIVQKYWKPNFHVLPAGKRSGNASILLNSQVMHEMVEQALQQYDYVILDTAPMSVSNDAAVFGRLADGVVMV
                                                     VILDTAP                    
       410       420       430       440       450       460         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
VGKGVAEKKELESTVQALSTAEVPVLGYVFNFADPKKIHSKNYYYYGESAPKGDKGKNKAKDKDKNKRH
VGKGVAEKKELESTVQALSTAEVPVLGYVFNFADPKKIHSKNYYYYGESAPKGDK              
                                          YYYY                       
© 1998-2019