BYKdb

Annotate results for A0A087IRN0

A0A087IRN0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A087IRN0
DOMAINtad28/211ELFQFGSYLKVLRKHWFSIVTLSLVITLAATWFIYSKPSIYQATATILIQEEQRNALSIE
EVYGLDTTKKEYFQTQIAILQSNHIADKIIQQFDLTNHPHFTGSSSLKTKLNELKSVPLI
QDLLNVSPNPTETNEYHSSYYEALQSYKNRVDIDPIRNTQLVKVSFRSADPKLAAEIANA
IGQA
DOMAINcd558/739TSAIPEEGKTATCINIASTFSNLERVLLIDCDLRRPSLEKRFNIPAQVPGLSNILTMNTP
LEECIVRIEEANLDVLTAGLLPPNPQELLSSKRFQNLLNTLQEKYDRIIIDTPPLLSVSD
ALILGQLAQGLITVIRSDSTKVALAKTALSKQRQHDIPSFGVVISQATTPQEEAHYVQKY
AY
SITEWalker A565/567GKT
SITEWalker A'584/591LLIDCDLR
SITEWalker B665/671IIIDTPP
SITEY Cluster733/739YVQKYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNRASSRVNGYTAMNENQTNRYYIGNKELFQFGSYLKVLRKHWFSIVTLSLVITLAATWFIYSKPSIYQATATILIQEEQ
                           ELFQFGSYLKVLRKHWFSIVTLSLVITLAATWFIYSKPSIYQATATILIQEEQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNALSIEEVYGLDTTKKEYFQTQIAILQSNHIADKIIQQFDLTNHPHFTGSSSLKTKLNELKSVPLIQDLLNVSPNPTET
RNALSIEEVYGLDTTKKEYFQTQIAILQSNHIADKIIQQFDLTNHPHFTGSSSLKTKLNELKSVPLIQDLLNVSPNPTET

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEYHSSYYEALQSYKNRVDIDPIRNTQLVKVSFRSADPKLAAEIANAIGQAYIDSNFEAKLAVTQNATNWLDSNARQLED
NEYHSSYYEALQSYKNRVDIDPIRNTQLVKVSFRSADPKLAAEIANAIGQA                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLHKSEQALQQFLTTEGLVDINGIDDIYANELEELSKKLNIAIEKRIQAQTLSDLLLRKSAQNLDSLLSIDEFANQAQIR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELKMLESNAEKLVGELSQRYGPKHDKMIQAKAQLQNIQARSQQLIMEMVLSKQQDLKVAQSFENSIRREMSNKKAEIQLV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGKKAEYEKLKRDVESNRELLKAFVNREKETTATSDFRNVNARFTDKALEPLFPIAPQRLKLVIICAVFALFFSSAAAII


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDMIKDVIRTPEDVENKLGLSCIGTLPYVRSRKLRKPGVSFQAYLDPQNRVFSEACRSIRTSLLLRLVNSKQKVLVFTSA
                                                                             TSA

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPEEGKTATCINIASTFSNLERVLLIDCDLRRPSLEKRFNIPAQVPGLSNILTMNTPLEECIVRIEEANLDVLTAGLLPP
IPEEGKTATCINIASTFSNLERVLLIDCDLRRPSLEKRFNIPAQVPGLSNILTMNTPLEECIVRIEEANLDVLTAGLLPP
    GKT                LLIDCDLR                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPQELLSSKRFQNLLNTLQEKYDRIIIDTPPLLSVSDALILGQLAQGLITVIRSDSTKVALAKTALSKQRQHDIPSFGVV
NPQELLSSKRFQNLLNTLQEKYDRIIIDTPPLLSVSDALILGQLAQGLITVIRSDSTKVALAKTALSKQRQHDIPSFGVV
                        IIIDTPP                                                 
       730         
....:....|....:....
ISQATTPQEEAHYVQKYAY
ISQATTPQEEAHYVQKYAY
            YVQKYAY

© 1998-2019