BYKdb

Annotate results for A0A087LTV7

A0A087LTV7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A087LTV7
DOMAINcd342/534SSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPAE
PRQLKAMMAEDDVSGVRIALGGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLG
SVVDGLHLARLADVVTFVMRYRSVPRNAAAQALAALARTRREQSELVGVLNLGPAPTGSK
AYRAATYVPKLSP
SITEWalker A349/351GKT
SITEWalker A'369/376LLIDCDLR
SITEWalker B453/459VIIDSPP
SITEY Cluster523/528YRAATY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHEDAWDLRGLEGAIRRQWRVVALAVAAGLALASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASEPVLASAARALGLAGEQAPDWLGSRVKVQREGPTYLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVAA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRARVTVAGEAVRAAQQALALRSGFEERQALASAQSHYRMLLDRLTRLEAEAFLQVPSARIAAAASPPVAPSSPKVGLTL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALAGGLALIFGLLLAFARERVTPGFVDAEEAGRRLGLEPILTIPRQKLQRGRDGELWLTPADQLAQAPLAEFPEAVRRLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISVDQALQRKSVAHRGAVVMVSSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPA
                     SSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPA
                            GKT                 LLIDCDLR                        
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPRQLKAMMAEDDVSGVRIALGGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLGSVVDGLHLARLADVVTFVM
EPRQLKAMMAEDDVSGVRIALGGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLGSVVDGLHLARLADVVTFVM
                                                    VIIDSPP                     
       490       500       510       520       530       540   
....:....|....:....|....:....|....:....|....:....|....:....|...
RYRSVPRNAAAQALAALARTRREQSELVGVLNLGPAPTGSKAYRAATYVPKLSPSLRQASHWH
RYRSVPRNAAAQALAALARTRREQSELVGVLNLGPAPTGSKAYRAATYVPKLSP         
                                          YRAATY               
© 1998-2019