BYKdb

Annotate results for A0A088TM87

A0A088TM87 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A088TM87
DOMAINcd41/222TSTFPSEGKTVTSINLAMVYAQTGKKVLLVDMDLRIPKIHRFFNLPNKDGISGYVDSRDI
KKCIQKGTDNLDILVTGKKTPFPSELLASKVVNEMMEKLRDMYDVIIIDCPPMTAVTDAS
IISNFSDGTVYVLASRRTNRDMANKAINDLKKNGANILGGVLTRVSKRDSNYGADYYYYY
GE
SITEWalker A48/50GKT
SITEWalker A'68/75LLVDMDLR
SITEWalker B146/152IIIDCPP
SITEY Cluster212/220YGADYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSYKIITKEEPHSVVTEQYKKVRTAIDFSSIDKKVKVINLTSTFPSEGKTVTSINLAMVYAQTGKKVLLVDMDLRIPKIH
                                        TSTFPSEGKTVTSINLAMVYAQTGKKVLLVDMDLRIPKIH
                                               GKT                 LLVDMDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFFNLPNKDGISGYVDSRDIKKCIQKGTDNLDILVTGKKTPFPSELLASKVVNEMMEKLRDMYDVIIIDCPPMTAVTDAS
RFFNLPNKDGISGYVDSRDIKKCIQKGTDNLDILVTGKKTPFPSELLASKVVNEMMEKLRDMYDVIIIDCPPMTAVTDAS
                                                                 IIIDCPP        
       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
IISNFSDGTVYVLASRRTNRDMANKAINDLKKNGANILGGVLTRVSKRDSNYGADYYYYYGE
IISNFSDGTVYVLASRRTNRDMANKAINDLKKNGANILGGVLTRVSKRDSNYGADYYYYYGE
                                                   YGADYYYYY  
© 1998-2019