BYKdb

Annotate results for A0A089L5M6

A0A089L5M6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A089L5M6
DOMAINcd47/228TSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDMRKPTAHKTFSLSNRHGLSSLLSQQTN
LNEAIQESGVPNLSIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPPLLAVTD
AQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYY
GN
SITEWalker A54/56GKS
SITEWalker A'74/81LLIDGDMR
SITEWalker B154/160IMFDTPP
SITEY Cluster221/226YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSIDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
                                              TSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
                                                     GKS                 LLIDGDM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTAHKTFSLSNRHGLSSLLSQQTNLNEAIQESGVPNLSIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
RKPTAHKTFSLSNRHGLSSLLSQQTNLNEAIQESGVPNLSIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
R                                                                        IMFDTPP
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
                                                            YYYYYY  
© 1998-2019