BYKdb

Annotate results for A0A090E9E3

A0A090E9E3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A090E9E3
DOMAINtad24/219DFIDVERLLGMAARQVKVVAVCAVIGLFLGVIYLQTTPKQFTSVASVLIDEGLNKVVDDI
SAANVTQQTDATILSQIEILTSARLASVVVDKLKLDQNDEFMNPPQSALAQGVGFLRNVV
AYFRGGSSVDDIPGIQNVDAATRQAMINVARHDYAVLKLQTELMADRNGRSNVITIGYQS
TNPALATAITKAYAEA
DOMAINcd589/779ISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDLRNPGLSRSLGMESEHGLMEAVVSGQT
WQSVGKVDRQTKLAIIPAVLRGQFSHTGELLGSAGMRRFIENAKETFEYIIVDLPPLGPV
VDAKAFAPLADGFVLVTEWGRTPRAMVRSMLESEPYIADKVVGAVLNKVDLKKLAKYGSF
GGSEKFFDRYS
SITEWalker A596/598GKS
SITEWalker A'616/623LLIDGDLR
SITEWalker B698/704IIVDLPP
SITEY Cluster778/782YSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNYANFPLDKRMPLPSTEAEKGEDFIDVERLLGMAARQVKVVAVCAVIGLFLGVIYLQTTPKQFTSVASVLIDEGLNKVV
                       DFIDVERLLGMAARQVKVVAVCAVIGLFLGVIYLQTTPKQFTSVASVLIDEGLNKVV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDISAANVTQQTDATILSQIEILTSARLASVVVDKLKLDQNDEFMNPPQSALAQGVGFLRNVVAYFRGGSSVDDIPGIQN
DDISAANVTQQTDATILSQIEILTSARLASVVVDKLKLDQNDEFMNPPQSALAQGVGFLRNVVAYFRGGSSVDDIPGIQN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDAATRQAMINVARHDYAVLKLQTELMADRNGRSNVITIGYQSTNPALATAITKAYAEAYLADQLNASFDATERAAVWLQ
VDAATRQAMINVARHDYAVLKLQTELMADRNGRSNVITIGYQSTNPALATAITKAYAEA                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLNELRQSSQQAAMEVEKFRAEHGLSANSDGQLLSGKQLADLNAQLIIAQADTARASARYQQYKAIVDSGSENAFNDSA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IASDQPSSSVIIALKTRYLAVSKRLQDVEANYGKDHPQAVALTKEKADVSAQIFGQLKQITESYRNDFQVAQARETELKQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIATAAGQSSADNESQVRLRELDQQAQALSTLYQTFLSRYQEASQQQSFPVGKVRIISDANMPLAASSPRTLRVMALSLV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLMLGAGFGGLNEFNERFFRTGEDVRDRVGLKFLGYLPTIGGGKAKDTKSDDLPADGKVTSLSAAERRARMRVSLDAPA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMFAETLRNAKIAFDVVMEDKGSRVVGVISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDLRNPGLSRSLGMESEHGLM
                            ISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDLRNPGLSRSLGMESEHGLM
                                   GKS                 LLIDGDLR                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAVVSGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTGELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLADG
EAVVSGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTGELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLADG
                                                         IIVDLPP                
       730       740       750       760       770       780       790    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
FVLVTEWGRTPRAMVRSMLESEPYIADKVVGAVLNKVDLKKLAKYGSFGGSEKFFDRYSSYYLEKSDARAKQAA
FVLVTEWGRTPRAMVRSMLESEPYIADKVVGAVLNKVDLKKLAKYGSFGGSEKFFDRYS               
                                                         YSSYY            

© 1998-2019