BYKdb

Annotate results for A0A090FD69

A0A090FD69 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A090FD69
DOMAINtad24/218DFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSVASVLVDEGLNKVVDDI
SAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVV
GYFRGSSAGDIPGIENVDEATRQAMIKTATHDYAVLKLQSEVLAQRNGRSYVISIGYQAP
DPALATAITKAYADA
DOMAINcd588/778ISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVNGQT
WQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPV
VDAKAFAPLVDGFVLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGAL
GGSERFFDRYS
SITEWalker A595/597GKS
SITEWalker A'615/622LLIDGDLR
SITEWalker B697/703IIVDLPP
SITEY Cluster777/781YSTYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNYANFPLDKRVPLPGADQEKGEDFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSVASVLVDEGLNKVV
                       DFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSVASVLVDEGLNKVV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSAGDIPGIENV
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSAGDIPGIENV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEATRQAMIKTATHDYAVLKLQSEVLAQRNGRSYVISIGYQAPDPALATAITKAYADAYLADQLNASFDATERAALWLQG
DEATRQAMIKTATHDYAVLKLQSEVLAQRNGRSYVISIGYQAPDPALATAITKAYADA                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLTELRESSQRAAMAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSESAFNDSAI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GADQPSSSVIIGLKTRYLAIAKRLQDVETNFGKDHPQAIALAKEKADVLAQIFGQLKQLTESYRNDFQVAQAREQALRDK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDATMPLAASSPRTLRVLALSLVL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLMLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPTIGGGKAKDSKADDLPADGKVASLSAAEKRARMRVSIDAPAS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFAETLRNAKIAFDVVMEDRSSRVIGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLME
                           ISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLME
                                  GKS                 LLIDGDLR                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
                                                        IIVDLPP                 
       730       740       750       760       770       780       790   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSTYYLEKSEQRPKQAA
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYS               
                                                        YSTYY            

© 1998-2019