BYKdb

Annotate results for A0A090IJ94

A0A090IJ94 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A090IJ94
DOMAINtad16/222DIVLPSPHWHVVQRYKWRIFLLSAFVSLSAALYLSKEQPLYRASATLLIEANQAQAVSFD
SVQGLDSNRKEYYLTQFEILKSKSIAETVFDRLNLQQQPSFQKRESWRDKAVAYILDVSP
LLKSFIMNIDSEFAENIGAGYISGVPQSATDISNQALESQQVKISRLRQFSKRLMVTPIR
KTQLVKLSFESEDPALAAMIANAVGEA
DOMAINcd572/764ISSQPNEGKSTTATNIAFSLAQIEKTVLIDADMRKPSLAKNFNIPKDKPGLAQVITGDAN
LSDCITVDPASGVHVMACGPTPKNAQELLSSKRFKQLLESLRQSYDRVVIDTPPIQAVSD
SLIISLHTDAIIYVIKSEATRVRLVQNGIRRLAKVDANLVGIVMNHVNTDGVADSEYYYG
YYSDDDYAEKSTK
SITEWalker A579/581GKS
SITEWalker A'598/605VLIDADMR
SITEWalker B679/685VVIDTPP
SITEY Cluster748/758YYYGYYSDDDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDKLEQSLNKSSVNKDIVLPSPHWHVVQRYKWRIFLLSAFVSLSAALYLSKEQPLYRASATLLIEANQAQAVSFDSVQGL
               DIVLPSPHWHVVQRYKWRIFLLSAFVSLSAALYLSKEQPLYRASATLLIEANQAQAVSFDSVQGL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSNRKEYYLTQFEILKSKSIAETVFDRLNLQQQPSFQKRESWRDKAVAYILDVSPLLKSFIMNIDSEFAENIGAGYISGV
DSNRKEYYLTQFEILKSKSIAETVFDRLNLQQQPSFQKRESWRDKAVAYILDVSPLLKSFIMNIDSEFAENIGAGYISGV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQSATDISNQALESQQVKISRLRQFSKRLMVTPIRKTQLVKLSFESEDPALAAMIANAVGEAYIAQDLEVKSSINKNAAH
PQSATDISNQALESQQVKISRLRQFSKRLMVTPIRKTQLVKLSFESEDPALAAMIANAVGEA                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WLTKRLEGLRRSLDESETLLQAYRKEENIIDLQDRGGRGLTGLVSNELEQTSYQLVEAKNEVNQLRSIVRAINEYGVKNL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENLESIPEITSHPIIQNIKKLKVRAKLKVSELSQIYGRKHPDLIAAKSELYTVNKHLTIQISKLVSGLDRELKTKKSNVA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALERQYSKIQNQFQDVIGKDNEYQKLVRDVESNRKLYNTFLERSKETALTSDFNAAVARFTDRAKAPNKPITLSTKIVII


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVFILTMLLHIAYLLVKEYFTDNFNSVGDIENKLGLPVLGVLPKVARKRNQDLDLHYFFDEDGRQFSESVRTLRTSFLLA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGQRVNQVIGIISSQPNEGKSTTATNIAFSLAQIEKTVLIDADMRKPSLAKNFNIPKDKPGLAQVITGDANLSDCITVDP
           ISSQPNEGKSTTATNIAFSLAQIEKTVLIDADMRKPSLAKNFNIPKDKPGLAQVITGDANLSDCITVDP
                  GKS                VLIDADMR                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASGVHVMACGPTPKNAQELLSSKRFKQLLESLRQSYDRVVIDTPPIQAVSDSLIISLHTDAIIYVIKSEATRVRLVQNGI
ASGVHVMACGPTPKNAQELLSSKRFKQLLESLRQSYDRVVIDTPPIQAVSDSLIISLHTDAIIYVIKSEATRVRLVQNGI
                                      VVIDTPP                                   
       730       740       750       760     
....:....|....:....|....:....|....:....|....:
RRLAKVDANLVGIVMNHVNTDGVADSEYYYGYYSDDDYAEKSTKS
RRLAKVDANLVGIVMNHVNTDGVADSEYYYGYYSDDDYAEKSTK 
                           YYYGYYSDDDY       

© 1998-2019