BYKdb

Annotate results for A0A090R136

A0A090R136 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A090R136
DOMAINcd263/452SGPSPGIGKSFVSANMAAVIAKSGQKVLVVDADMRKGRMEKQMAVNPTPGLSTYLSGQTN
IESLIKQPGIEGLDFIGRGEVPPNPSELLMHPRFKQLMDWAVEQYDIVIVDTPPILAVTD
AAIVGAHAGTSLLVGRFGQNAVKEIEVTKQRFEQNGIEIKGFILNAVVRKASTYYGGNYG
YYNYSYESNK
SITEWalker A270/272GKS
SITEWalker A'290/297LVVDADMR
SITEWalker B370/376VIVDTPP
SITEY Cluster436/448YYGGNYGYYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHFLSDHLPNIKSQLTIAEDLLNAYRQENESIDLGLEAKSTLDMMVKIESQLNELTFKESEISQRFTKEHPAYIALLDKK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVLISERKKINKQVQDLPKTQREVLRLTRDVEVNQQIYIQLLNKVQELNIMKASTVGNVRVLDEAQIYPNAVKPNKALLV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AISVMMGFLLSIIGVLLRAAFHRGIENPDEIEAIGLPVYASIPMSDWQVELEKKQNRKKTLTVQDTLLAISNPADLSIEA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRSLRTSLHFAMMEAKNNIIMISGPSPGIGKSFVSANMAAVIAKSGQKVLVVDADMRKGRMEKQMAVNPTPGLSTYLSGQ
                      SGPSPGIGKSFVSANMAAVIAKSGQKVLVVDADMRKGRMEKQMAVNPTPGLSTYLSGQ
                             GKS                 LVVDADMR                       
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNIESLIKQPGIEGLDFIGRGEVPPNPSELLMHPRFKQLMDWAVEQYDIVIVDTPPILAVTDAAIVGAHAGTSLLVGRFG
TNIESLIKQPGIEGLDFIGRGEVPPNPSELLMHPRFKQLMDWAVEQYDIVIVDTPPILAVTDAAIVGAHAGTSLLVGRFG
                                                 VIVDTPP                        
       410       420       430       440       450  
....:....|....:....|....:....|....:....|....:....|..
QNAVKEIEVTKQRFEQNGIEIKGFILNAVVRKASTYYGGNYGYYNYSYESNK
QNAVKEIEVTKQRFEQNGIEIKGFILNAVVRKASTYYGGNYGYYNYSYESNK
                                   YYGGNYGYYNYSY    
© 1998-2019