BYKdb

Annotate results for A0A091BU30

A0A091BU30 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A091BU30
DOMAINcd41/233TSAQPGEGKSTTSTNLAISFAKAGFRTLLIDADTRNSVMSGTFKSKERYDGLTSYLSGNA
ELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYVIIDTPPLGRVV
DAVIIAHSSDASLLVTKPGADKRRTITKLKEQLEQSGAVFLGVILNQFDIRRDYYGSYGS
YGSYGEYGKSSKK
SITE-228/-230GKS
SITEWalker A'68/75LLIDADTR
SITEWalker B149/155VIIDTPP
SITE-89/-148YDGLTSYLSGNAELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDY
SITEY Cluster214/227YYGSYGSYGSYGEY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPQLELVRAKAQMIKNLEEYYNTIRTNIQFSGRNLKVIALTSAQPGEGKSTTSTNLAISFAKAGFRTLLIDADTRNSVMS
                                        TSAQPGEGKSTTSTNLAISFAKAGFRTLLIDADTRNSVMS
                                               GKS                 LLIDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKSKERYDGLTSYLSGNAELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYVIIDTPPLGRVV
GTFKSKERYDGLTSYLSGNAELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYVIIDTPPLGRVV
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAVIIAHSSDASLLVTKPGADKRRTITKLKEQLEQSGAVFLGVILNQFDIRRDYYGSYGSYGSYGEYGKSSKKEDKK
DAVIIAHSSDASLLVTKPGADKRRTITKLKEQLEQSGAVFLGVILNQFDIRRDYYGSYGSYGSYGEYGKSSKK    
                                                     YYGSYGSYGSYGEY          
© 1998-2019