BYKdb

Annotate results for A0A091C4A8

A0A091C4A8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A091C4A8
DOMAINcd414/603TSASPSEGKSTTAFMLAQNFAQLGKRVLIIDADLRNPSLHRAVGSDNSAGLSNYLSGAAK
AMDVIKQTELSNFSFLSSGPLPPNPAELLAGPKMIALVKVASDKYDHVIIDGPPVMGLAD
APTLANMTSGTLLVIEAGGTRVAHAKNALKRLQAARARVIGALLTKFDAKVSGYHYGGYN
YYSYGAGEST
SITEWalker A421/423GKS
SITEWalker A'441/448LIIDADLR
SITEWalker B521/527VIIDGPP
SITEY Cluster587/597YHYGGYNYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTAPAPWKLLLGLAGETDDEELDAAHLAATESVRQTLRINSFLASLSIEPVRNSRLVRVHFDSPDAAFSQRVVNAVAEAY


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IASNLERRFDASSYAKTFLEERLEQLRIQLEDSESRLVEFAQRERIVDAIDGSSLSTQSLSELNSTLAAAQDQRIRAEAR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WKHAESASGMGLSAVLGSEIVQALQERRADLQAQYQDKLSIFKPAFPEMQQLQAQIDELDRQIQTEVGNIKAAIRGEYES


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALAQEQMLRAQIDALKDEVLDLRNRSIEYNILRREVDTNRQQYDALLQRYKEIGVAGGVGTNNISIVDPAELPISKYKPR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSMNLAIGLLLGLVVGLLLALLFEVIDDSVKHPEDVERLLGQAVLGVIPLLKSPMTPARAIADPRSAFAEAYRSLRTALQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FATESGVPRSLLITSASPSEGKSTTAFMLAQNFAQLGKRVLIIDADLRNPSLHRAVGSDNSAGLSNYLSGAAKAMDVIKQ
             TSASPSEGKSTTAFMLAQNFAQLGKRVLIIDADLRNPSLHRAVGSDNSAGLSNYLSGAAKAMDVIKQ
                    GKS                 LIIDADLR                                
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELSNFSFLSSGPLPPNPAELLAGPKMIALVKVASDKYDHVIIDGPPVMGLADAPTLANMTSGTLLVIEAGGTRVAHAKN
TELSNFSFLSSGPLPPNPAELLAGPKMIALVKVASDKYDHVIIDGPPVMGLADAPTLANMTSGTLLVIEAGGTRVAHAKN
                                        VIIDGPP                                 
       570       580       590       600         
....:....|....:....|....:....|....:....|....:....
ALKRLQAARARVIGALLTKFDAKVSGYHYGGYNYYSYGAGESTKKLTAS
ALKRLQAARARVIGALLTKFDAKVSGYHYGGYNYYSYGAGEST      
                          YHYGGYNYYSY            
© 1998-2019