BYKdb

Annotate results for A0A091C8N8

A0A091C8N8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A091C8N8
DOMAINcd52/231TSSGPREGKSLTSANLAVVFAQTGQKVLLVDADMRKPTIHKTFQLSNEAGLSTVLSTGVS
LEETAQKTTIENLSILTSGPKPPNPSELLGSEKMNQIMEEARHLFDMVIFDMPPVVTVTD
AQVMSSKADGTLLVARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
SITEWalker A59/61GKS
SITEWalker A'79/86LLVDADMR
SITEWalker B159/165VIFDMPP
SITEY Cluster226/229YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKERTNTKTQPVSLISLVDPSSSVAEQYRTIRTNLQFASSADQQVQTLVVTSSGPREGKSLTSANLAVVFAQTGQKVLL
                                                   TSSGPREGKSLTSANLAVVFAQTGQKVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADMRKPTIHKTFQLSNEAGLSTVLSTGVSLEETAQKTTIENLSILTSGPKPPNPSELLGSEKMNQIMEEARHLFDMVI
VDADMRKPTIHKTFQLSNEAGLSTVLSTGVSLEETAQKTTIENLSILTSGPKPPNPSELLGSEKMNQIMEEARHLFDMVI
VDADMR                                                                        VI
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
FDMPPVVTVTDAQVMSSKADGTLLVARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
FDMPPVVTVTDAQVMSSKADGTLLVARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
FDMPP                                                            YYYY  
© 1998-2019