BYKdb

Annotate results for A0A095AS77

A0A095AS77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A095AS77
DOMAINtad1/141MAAAIVIAAAAYLAAEPRYLATAQVALERTAEQVIKVDSVIPTTDPDSAAVDTEVQVLRS
PELIGRVVDRLKLERDPAFNEAAGQGRPTAQPDLIGRQRAIGTLLSGLTVKRDGLSYAIS
VSFEGGTPVQSAQIANALVDD
DOMAINcd491/678TSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFADGVKLGLDEVLAGQAT
LEQAIVKDSMSGAFLLPQRLDSKGVGLTESPRLAELIEEVRGRYDLVILDTPPVLPVDEA
RVIASMADGVVFLVRWRKTPAKAASVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGG
TFLKSYRP
SITEWalker A498/500GKT
SITEWalker A'518/525LLIDADAR
SITEWalker B597/603VILDTPP
SITEY Cluster676/680YRPYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAAAIVIAAAAYLAAEPRYLATAQVALERTAEQVIKVDSVIPTTDPDSAAVDTEVQVLRSPELIGRVVDRLKLERDPAFN
MAAAIVIAAAAYLAAEPRYLATAQVALERTAEQVIKVDSVIPTTDPDSAAVDTEVQVLRSPELIGRVVDRLKLERDPAFN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAAGQGRPTAQPDLIGRQRAIGTLLSGLTVKRDGLSYAISVSFEGGTPVQSAQIANALVDDYVSGQVGSKTEATHRARGF
EAAGQGRPTAQPDLIGRQRAIGTLLSGLTVKRDGLSYAISVSFEGGTPVQSAQIANALVDD                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEQRLQDLRAQVVGAEREVADYRAAHNLFAVSEASSVTQQELSGLSTQLAQAKAENAAAQARLSAARAQLSGGRTGEELG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSLDSPVVSQLRAQRAEVAREVGALEKRYGPRHPDLVRAQSQLRVADQQIAAEVQRIVSNVAIQASIANQRAGSLAGSVA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSEGKLASDNAASVRLNELERNAESARTLYQAFLDRYRQTVAQSGLERSDAYIVSRARVPSAPSSPNMLIYAAMAVVGGL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIGVLLVVLLQLLERGIETSDAIEETLGLSTLASIPDANTLPGYRKLGPPAPPAELLLKRPQSTYAEAFRTLRTSIQFAE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAGPIRVVAITSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFADGVKLGLDEVLAGQATLEQAIVKDSM
          TSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFADGVKLGLDEVLAGQATLEQAIVKDSM
                 GKT                 LLIDADAR                                   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGAFLLPQRLDSKGVGLTESPRLAELIEEVRGRYDLVILDTPPVLPVDEARVIASMADGVVFLVRWRKTPAKAASVALRR
SGAFLLPQRLDSKGVGLTESPRLAELIEEVRGRYDLVILDTPPVLPVDEARVIASMADGVVFLVRWRKTPAKAASVALRR
                                    VILDTPP                                     
       650       660       670       680  
....:....|....:....|....:....|....:....|..
LYDVHAEMLGAVLTLVDVREQERAGYEDGGTFLKSYRPYYAD
LYDVHAEMLGAVLTLVDVREQERAGYEDGGTFLKSYRP    
                                   YRPYY  
© 1998-2019