BYKdb

Annotate results for A0A095CTW3

A0A095CTW3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A095CTW3
DOMAINcd65/246TSPSPGSGKTTTTANLASSFGRQVDLRSVVMDMDMRRPSLARVFGHSGTYSVFDVLEETV
PFAEQALRFGKNVALSMNTKTARDPSELFLRRRTAEIIDEIENTYQPGIMLFDMPPVLSN
DDTRAFLDNVDCALIVAEAEQSTIKQIDLCERELAEQTNVLGIVLNKCRFSDDSYGYGYG
LN
SITEWalker A72/74GKT
SITEWalker A'93/100VVMDMDMR
SITEWalker B174/180MLFDMPP
SITEY Cluster239/243YGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVRPLQQNVVEAWDALQPLSADPKLLQRNRVYTSLGNAHATPYDMLRTKMFQLMNANGWRRVAITSPSPGSGKTTTTANL
                                                                TSPSPGSGKTTTTANL
                                                                       GKT      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASSFGRQVDLRSVVMDMDMRRPSLARVFGHSGTYSVFDVLEETVPFAEQALRFGKNVALSMNTKTARDPSELFLRRRTAE
ASSFGRQVDLRSVVMDMDMRRPSLARVFGHSGTYSVFDVLEETVPFAEQALRFGKNVALSMNTKTARDPSELFLRRRTAE
            VVMDMDMR                                                            
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDEIENTYQPGIMLFDMPPVLSNDDTRAFLDNVDCALIVAEAEQSTIKQIDLCERELAEQTNVLGIVLNKCRFSDDSYG
IIDEIENTYQPGIMLFDMPPVLSNDDTRAFLDNVDCALIVAEAEQSTIKQIDLCERELAEQTNVLGIVLNKCRFSDDSYG
             MLFDMPP                                                          YG
      
....:.
YGYGLN
YGYGLN
YGY   
© 1998-2019