BYKdb

Annotate results for A0A095D3A6

A0A095D3A6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A095D3A6
DOMAINtad16/192SAPTILEYWNALKRHAWLASAILAVTLVVGVILTLLMTPQYTATSRIEIAREQANVTNVE
GLKREDSTPNQEFYLTQYSLLNARSLAERVERRLRLSSNKDFFAAHGVTPEGEGFLSSEG
SAPVSVERMRGRQRQAVDLLLKNVAISPLRGSALIDISYTSASPNISQSVARTWVGE
DOMAINcd532/721TSTSPAEGKSTSAYSLALVLGRTSGSVVLVDVDMRRPILASRLGLQNLRGVSNFLAGDDS
WEQLIQDTGKSNVHFIAAGPTPPSASELLSGERLALFVQKLASRYDHVILDSPPMLGLSD
APLIANVVEGVVYVIEADRTAVRASQSAIQRLRDSRAHLLGALLTKYRAKQSGYGYGYGY
GYGYGRDGAE
SITE-600/-602GKS
SITEWalker A'559/566VLVDVDMR
SITEWalker B639/645VILDSPP
SITEY Cluster705/715YGYGYGYGYGY
SITEWalker A539/541GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFSQDGTAAGTHQFWSAPTILEYWNALKRHAWLASAILAVTLVVGVILTLLMTPQYTATSRIEIAREQANVTNVEGLKRE
               SAPTILEYWNALKRHAWLASAILAVTLVVGVILTLLMTPQYTATSRIEIAREQANVTNVEGLKRE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSTPNQEFYLTQYSLLNARSLAERVERRLRLSSNKDFFAAHGVTPEGEGFLSSEGSAPVSVERMRGRQRQAVDLLLKNVA
DSTPNQEFYLTQYSLLNARSLAERVERRLRLSSNKDFFAAHGVTPEGEGFLSSEGSAPVSVERMRGRQRQAVDLLLKNVA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISPLRGSALIDISYTSASPNISQSVARTWVGEFAQQSMDRRFASTSDARIYLETRLQGLRERLEQSERDLVNYAARQGIV
ISPLRGSALIDISYTSASPNISQSVARTWVGE                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLSESKSGEGRTQTTQTLASSNLEQLNRVLIEATAERTAAEAKLRAARSPGSTELALQNQSLNLLRQKRAEAQAKYQDLL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHFEPEYPEAKAGREQVAALDRAISAEERRVRDAYLSEFDAASQREQDLRQRVNGLLDKFDTESRSNIQYNIYQREVDTN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLYDSLLQRYKEIGVAGVGTNNISVVDSAPMPEKPSSPKLLINVIMALLAGLVLAAIAVIVLENLDESLREPGQVSTKL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVPLLGAIPVVDDDALEKLDDPKSILSEAYMTVRTNLSFSTDHGVPKTMALTSTSPAEGKSTSAYSLALVLGRTSGSVVL
                                                   TSTSPAEGKSTSAYSLALVLGRTSGSVVL
                                                          GKS                 VL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVDMRRPILASRLGLQNLRGVSNFLAGDDSWEQLIQDTGKSNVHFIAAGPTPPSASELLSGERLALFVQKLASRYDHVI
VDVDMRRPILASRLGLQNLRGVSNFLAGDDSWEQLIQDTGKSNVHFIAAGPTPPSASELLSGERLALFVQKLASRYDHVI
VDVDMR                                                                        VI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDSPPMLGLSDAPLIANVVEGVVYVIEADRTAVRASQSAIQRLRDSRAHLLGALLTKYRAKQSGYGYGYGYGYGYGRDGA
LDSPPMLGLSDAPLIANVVEGVVYVIEADRTAVRASQSAIQRLRDSRAHLLGALLTKYRAKQSGYGYGYGYGYGYGRDGA
LDSPP                                                           YGYGYGYGYGY     
       730
....:....|
EDDSVGGVRN
E         

© 1998-2019