BYKdb

Annotate results for A0A095FCS2

A0A095FCS2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A095FCS2
DOMAINtad19/276EDVVLGQLIQVILDDIWLLLGIAALIVALAGVYCYLAKPIYSADAHVRVEAADNTSQALT
QTQTGAVINGGPATPATDAEIEIIKSRGVVGPVVEQCKLNFSVAPKTFPLLGAISARLAA
PGKLAKPWLGMSSYAWGGEQAAVDSIDVTPALEGKKLMLTAGADGAYTLANEDGGLLLRG
RVGERAEGNGVSLLVSQLVARPGTQFVVVRQNDLDAITAFQSAIQVSEQGKQTGVVQISL
EGKDPVQTAMIANALAQS
DOMAINcd554/740TGPTPGIGKSFLTVNLAALLAHSGKRVLLIDADMRRGALDRYFGVPRRNGLSELLSDQIA
LEEAIRETQVPGLSFIPTGQRPPNPSELLMSPRLALYLDGLGKRYDAVIVDSPPILAVTD
ATIFGVLAGSTFLVLRSGMHTEGEIGDSIKRLRTAGVQLQGGIFNGVPPRTRGYGRGYAS
VHEYLNA
SITEWalker A561/563GKS
SITEWalker A'581/588LLIDADMR
SITEWalker B661/667VIVDSPP
SITEY Cluster727/737YGRGYASVHEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTQVKHPYADMAAKPDDEDVVLGQLIQVILDDIWLLLGIAALIVALAGVYCYLAKPIYSADAHVRVEAADNTSQALTQT
                  EDVVLGQLIQVILDDIWLLLGIAALIVALAGVYCYLAKPIYSADAHVRVEAADNTSQALTQT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTGAVINGGPATPATDAEIEIIKSRGVVGPVVEQCKLNFSVAPKTFPLLGAISARLAAPGKLAKPWLGMSSYAWGGEQAA
QTGAVINGGPATPATDAEIEIIKSRGVVGPVVEQCKLNFSVAPKTFPLLGAISARLAAPGKLAKPWLGMSSYAWGGEQAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDSIDVTPALEGKKLMLTAGADGAYTLANEDGGLLLRGRVGERAEGNGVSLLVSQLVARPGTQFVVVRQNDLDAITAFQS
VDSIDVTPALEGKKLMLTAGADGAYTLANEDGGLLLRGRVGERAEGNGVSLLVSQLVARPGTQFVVVRQNDLDAITAFQS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIQVSEQGKQTGVVQISLEGKDPVQTAMIANALAQSYLQQHVNSKQAEANKMLDFLKSEEPRLKSDLERAEAALTEYQST
AIQVSEQGKQTGVVQISLEGKDPVQTAMIANALAQS                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGSINASDEAKVYLEGSIQYEQQIAAQRLQLASLEQRFTPEHPMVIAANQQLAQLQKERDKYADKFRSLPATEVKAVALQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNAKVAEDIYVLLLNRVQELSVQRAGTGGNIRLVDAALRPGVPVKPKKALILSAAVILGLIVGTGVVFLRRNLFHGIEDP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERVERMFNLPMYGLIPKSVELERLDAAAQKSGSDMRPILAVARPKDLSVESLRSLRTAMQFALMDAKNRVMVLTGPTPGI
                                                                         TGPTPGI

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSFLTVNLAALLAHSGKRVLLIDADMRRGALDRYFGVPRRNGLSELLSDQIALEEAIRETQVPGLSFIPTGQRPPNPSE
GKSFLTVNLAALLAHSGKRVLLIDADMRRGALDRYFGVPRRNGLSELLSDQIALEEAIRETQVPGLSFIPTGQRPPNPSE
GKS                 LLIDADMR                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLMSPRLALYLDGLGKRYDAVIVDSPPILAVTDATIFGVLAGSTFLVLRSGMHTEGEIGDSIKRLRTAGVQLQGGIFNGV
LLMSPRLALYLDGLGKRYDAVIVDSPPILAVTDATIFGVLAGSTFLVLRSGMHTEGEIGDSIKRLRTAGVQLQGGIFNGV
                    VIVDSPP                                                     
       730       740
....:....|....:....|
PPRTRGYGRGYASVHEYLNA
PPRTRGYGRGYASVHEYLNA
      YGRGYASVHEY   

© 1998-2019