BYKdb

Annotate results for A0A095TDI9

A0A095TDI9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A095TDI9
DOMAINtad15/251DQIDLGRLVGEIIDHRKLIISVTALFTVLAIVYSLFATPVYQADALIQVEQKQGNALLSS
LSQMLPDSQPESAPEIALLQSRMILGKTVDDLNLQAQIEQEYFPIFGKGWARLTGHKEGK
LTVSRLYVANQDGKTPSLLVTVGSNGQYTLTGGEYNLTGHIGKLLEARGISILVSDYNAE
KGTKFKINYITRLAAINTLQQSFSAADQGKDTGMLNLVLSGENPERIKEILQSISDN
DOMAINcd532/720SGASPNAGKTFITTNLAEVIAQGGQRVLFIDADMRKGYAHQIFKHSTDHGLSDILSGKST
VSQGIKPVSGAGFDFIARGAIPPNPAELLMHSRFRELIDWASQNYDLVLVDTPPILAVTD
AAVIGRYAGTTLLVARFEQNTAKELEVSIRRFEQSGVEIKGCILNGVIKKASSYYGYGYN
HYNYDYNSK
SITE-588/-590GKS
SITEWalker A'559/566LFIDADMR
SITEWalker B639/645VLVDTPP
SITEY Cluster705/717YYGYGYNHYNYDY
SITEWalker A539/541GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSTVTNKTASPDSDQIDLGRLVGEIIDHRKLIISVTALFTVLAIVYSLFATPVYQADALIQVEQKQGNALLSSLSQMLP
              DQIDLGRLVGEIIDHRKLIISVTALFTVLAIVYSLFATPVYQADALIQVEQKQGNALLSSLSQMLP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSQPESAPEIALLQSRMILGKTVDDLNLQAQIEQEYFPIFGKGWARLTGHKEGKLTVSRLYVANQDGKTPSLLVTVGSNG
DSQPESAPEIALLQSRMILGKTVDDLNLQAQIEQEYFPIFGKGWARLTGHKEGKLTVSRLYVANQDGKTPSLLVTVGSNG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYTLTGGEYNLTGHIGKLLEARGISILVSDYNAEKGTKFKINYITRLAAINTLQQSFSAADQGKDTGMLNLVLSGENPER
QYTLTGGEYNLTGHIGKLLEARGISILVSDYNAEKGTKFKINYITRLAAINTLQQSFSAADQGKDTGMLNLVLSGENPER

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKEILQSISDNYLAQNIARQAAQDTKSLDFLNKQLPQVRSDLDAAEDKLSAYRKRSDSVDLNMQARSALDQIVNVDNQLN
IKEILQSISDN                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLTFREAEVSQLFTKDHPTYRALLEKRQTLIQEKAKLNKQVSGMPATQQEVLRLSRDVDSGRAVYMQLLNRQQELNIAKN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIGNVRIVDDAVTEPKPIKPKKTLIVLIGIILGSFISVAVVLLRVFLRRGIESPEQLEELGINVYASVPVSEWMARQTP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRSLKVKGKQKENTSFLAVDNPADLAIEAVRSLRTSLHFAMMEARNNVLMISGASPNAGKTFITTNLAEVIAQGGQRVLF
                                                   SGASPNAGKTFITTNLAEVIAQGGQRVLF
                                                          GKT                 LF
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRKGYAHQIFKHSTDHGLSDILSGKSTVSQGIKPVSGAGFDFIARGAIPPNPAELLMHSRFRELIDWASQNYDLVL
IDADMRKGYAHQIFKHSTDHGLSDILSGKSTVSQGIKPVSGAGFDFIARGAIPPNPAELLMHSRFRELIDWASQNYDLVL
IDADMR                                                                        VL
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDTPPILAVTDAAVIGRYAGTTLLVARFEQNTAKELEVSIRRFEQSGVEIKGCILNGVIKKASSYYGYGYNHYNYDYNSK
VDTPPILAVTDAAVIGRYAGTTLLVARFEQNTAKELEVSIRRFEQSGVEIKGCILNGVIKKASSYYGYGYNHYNYDYNSK
VDTPP                                                           YYGYGYNHYNYDY   

© 1998-2019