BYKdb

Annotate results for A0A097APZ5

A0A097APZ5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A097APZ5
DOMAINcd42/231TSSLPNEGKSTVVKNLAYSVALTGSKVIVIDADLRNPTVHKLLYLPNSRGLTNLLIDEGD
YEAYLNIDNSYSNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTVT
DAVVLAPVVDGIILVIQAGKTEIEAVSRAKEILESVKANILGVVLNRVKESHKGYYYYYY
YYDDNNPQHK
SITE-180/-182GKT
SITEWalker A'69/76IVIDADLR
SITEWalker B150/156VFIDSPP
SITE-102/-149YEAYLNIDNSYSNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDY
SITEY Cluster216/223YYYYYYYY
SITEWalker A49/51GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVAARNLIVADPKSPFAEAFRALRTNLQFTSVDKKVKSILITSSLPNEGKSTVVKNLAYSVALTGSKVIVIDADLRNPTV
                                         TSSLPNEGKSTVVKNLAYSVALTGSKVIVIDADLRNPTV
                                                GKS                 IVIDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKLLYLPNSRGLTNLLIDEGDYEAYLNIDNSYSNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTV
HKLLYLPNSRGLTNLLIDEGDYEAYLNIDNSYSNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTV
                                                                     VFIDSPP    
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
TDAVVLAPVVDGIILVIQAGKTEIEAVSRAKEILESVKANILGVVLNRVKESHKGYYYYYYYYDDNNPQHKKRRKR
TDAVVLAPVVDGIILVIQAGKTEIEAVSRAKEILESVKANILGVVLNRVKESHKGYYYYYYYYDDNNPQHK     
                                                       YYYYYYYY             
© 1998-2019