BYKdb

Annotate results for A0A097RAE6

A0A097RAE6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A097RAE6
DOMAINcd50/226TSSVPGEGKSFSAANLAAVFAQQEKKVLLVDADLRKPTIHETYQLENVQGLTNVLVGNAS
LGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFDSPPLLAVAD
GQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
SITE-187/-189GKT
SITEWalker A'77/84LLVDADLR
SITEWalker B157/163VIFDSPP
SITE-151/-154YSRY
SITEY Cluster224/226YSY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
                                                 TSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
                                                        GKS                 LLVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
ADLR                                                                        VIFD
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
SPP                                                            YSY
© 1998-2019