BYKdb

Annotate results for A0A098EIC2

A0A098EIC2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A098EIC2
DOMAINcd53/235TSAAPSEGKSTASANLAVVFAQEGKRVLLVDADMRKPTTHYTFHMGNTQGLSSVLTRQIE
AEAAIRETEIERLDLLTCGPIPPNPAELLASKSMDALIEQLKETYDIIIFDAPPVLSVTD
GQILASKCEGTILVVNSGTTEKEMALKAKEAIASSNSRLIGAVLNNFILPKDNYYYQYYG
AEK
SITEWalker A60/62GKS
SITEWalker A'80/87LLVDADMR
SITEWalker B160/166IIFDAPP
SITEY Cluster226/231YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKRQKKVLQETARKVISFTNPRSYVAEQFRTLRTNINFSSPDSDIRSLLVTSAAPSEGKSTASANLAVVFAQEGKRVL
                                                    TSAAPSEGKSTASANLAVVFAQEGKRVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADMRKPTTHYTFHMGNTQGLSSVLTRQIEAEAAIRETEIERLDLLTCGPIPPNPAELLASKSMDALIEQLKETYDII
LVDADMRKPTTHYTFHMGNTQGLSSVLTRQIEAEAAIRETEIERLDLLTCGPIPPNPAELLASKSMDALIEQLKETYDII
LVDADMR                                                                        I
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
IFDAPPVLSVTDGQILASKCEGTILVVNSGTTEKEMALKAKEAIASSNSRLIGAVLNNFILPKDNYYYQYYGAEK
IFDAPPVLSVTDGQILASKCEGTILVVNSGTTEKEMALKAKEAIASSNSRLIGAVLNNFILPKDNYYYQYYGAEK
IFDAPP                                                           YYYQYY    
© 1998-2019