BYKdb

Annotate results for A0A098EJV4

A0A098EJV4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A098EJV4
DOMAINcd51/228TSAAPGEGKSTAAANLAVVFAQEGKKVLLIDGDMRKPTMHHTFEIRNTVGLSSVLTRRLP
VEAAIKKGPISGLHLLTCGPIPPNPAELLASETMAQLIQHLGKSYDLVIFDSPPILSVAD
GKLIADHCEGTVLIINSGTTEKRGALKAKEMIEMTSSKLLGIVLNNFTSTKETYYYQY
SITE-152/-154GKS
SITEWalker A'78/85LLIDGDMR
SITEWalker B158/164VIFDSPP
SITEY Cluster224/228YYYQY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKSKKKIDRTGRKLVAYTMPKSFVSEQFRNVRTNIHFSTPDKEIRSLAITSAAPGEGKSTAAANLAVVFAQEGKKVLLI
                                                  TSAAPGEGKSTAAANLAVVFAQEGKKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDMRKPTMHHTFEIRNTVGLSSVLTRRLPVEAAIKKGPISGLHLLTCGPIPPNPAELLASETMAQLIQHLGKSYDLVIF
DGDMRKPTMHHTFEIRNTVGLSSVLTRRLPVEAAIKKGPISGLHLLTCGPIPPNPAELLASETMAQLIQHLGKSYDLVIF
DGDMR                                                                        VIF
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
DSPPILSVADGKLIADHCEGTVLIINSGTTEKRGALKAKEMIEMTSSKLLGIVLNNFTSTKETYYYQY
DSPPILSVADGKLIADHCEGTVLIINSGTTEKRGALKAKEMIEMTSSKLLGIVLNNFTSTKETYYYQY
DSPP                                                           YYYQY
© 1998-2019