BYKdb

Annotate results for A0A098L087

A0A098L087 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A098L087
DOMAINcd55/235TSTGPGEGKSTTAANLAVVFAQQGKKTLLIDADLRKPTVHYTFRLNNYKGLTNVLTGSAP
LLPTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVIFDTPPVLAVTD
AQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQY
K
SITEWalker A62/64GKS
SITEWalker A'82/89LLIDADLR
SITEWalker B162/168VIFDTPP
SITEY Cluster228/234YYYYYQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKPLARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKK
                                                      TSTGPGEGKSTTAANLAVVFAQQGKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLLIDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFD
TLLIDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFD
 LLIDADLR                                                                       
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
 VIFDTPP                                                           YYYYYQY 
© 1998-2019