BYKdb

Annotate results for A0A098LL25

A0A098LL25 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A098LL25
DOMAINtad33/274GDFDFAKLLVIANKSLVWVILLVVLSITGAFLYVRYTKPVYESSSILKLDLKSEAGVLGL
NKFNDENMPGNKLSTISGEIEFLKSRYLYEKIVDRMKMNVSYFAYGNILYEERYNNSPFK
VIGEIKHPDFLDFKFDITFLDKDKFLLSYKKNDEEIKSEHYFGEKISTDNYSFTLYPTTF
WSTNETGAKYFFTMNSKEALVKNLMDNVSVSILNLDANTILLSYKNHNYSKATDIVNTID
SV
DOMAINcd609/796TSTVSGEGKTFVASNLSGVIALSNQKVILLDLDMRKPKVHLAFEKENFKGMSTVLIGKHT
LEECIQSTSISNLSFISAGPTPPNPSELILREEFDMLIKRLFEIYDVVVIDTPPVGLVTD
GILILRKADIPLYVVRTDYSKKSAKRNINKLVKTIPKLCVLMNALKAINTYGYGGYGYGY
GYGYYEGE
SITEWalker A616/618GKT
SITEWalker A'636/643ILLDLDMR
SITEWalker B716/722VVIDTPP
SITE-741/-747YVVRTDY
SITEY Cluster779/793YGYGGYGYGYGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLLEDEDKRSLNGSGQRVSFADDSEEEDDVFGDFDFAKLLVIANKSLVWVILLVVLSITGAFLYVRYTKPVYESSSILK
                                GDFDFAKLLVIANKSLVWVILLVVLSITGAFLYVRYTKPVYESSSILK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDLKSEAGVLGLNKFNDENMPGNKLSTISGEIEFLKSRYLYEKIVDRMKMNVSYFAYGNILYEERYNNSPFKVIGEIKHP
LDLKSEAGVLGLNKFNDENMPGNKLSTISGEIEFLKSRYLYEKIVDRMKMNVSYFAYGNILYEERYNNSPFKVIGEIKHP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DFLDFKFDITFLDKDKFLLSYKKNDEEIKSEHYFGEKISTDNYSFTLYPTTFWSTNETGAKYFFTMNSKEALVKNLMDNV
DFLDFKFDITFLDKDKFLLSYKKNDEEIKSEHYFGEKISTDNYSFTLYPTTFWSTNETGAKYFFTMNSKEALVKNLMDNV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVSILNLDANTILLSYKNHNYSKATDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKAEKDLETFVRNNR
SVSILNLDANTILLSYKNHNYSKATDIVNTIDSV                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVDVKQDFGKSGIKIEELEKEKQVLKSRISMLGELKDLILGDQEVNSFIPALSQVENPQLSAAINSLNTLQEERNRLLNS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRENTLVVKTKNKSIERIKENVLELIDINKRILHQQTAEINAKMVQLEQEVLSLPSKETEFTRLKRFYSIYEKFYLLLME


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEAEFGIAKAGTIPNFVILSPALNNPNPIYPKKIFIYISGLGIGIFLGISLIAIRYLLNDTISTQKELERSLHASMLGGI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEYSKEKMEVSKLVVDKNPKSAISEALRSIRTNLEFICPNKKKKLIAVTSTVSGEGKTFVASNLSGVIALSNQKVILLDL
                                                TSTVSGEGKTFVASNLSGVIALSNQKVILLDL
                                                       GKT                 ILLDL
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMRKPKVHLAFEKENFKGMSTVLIGKHTLEECIQSTSISNLSFISAGPTPPNPSELILREEFDMLIKRLFEIYDVVVIDT
DMRKPKVHLAFEKENFKGMSTVLIGKHTLEECIQSTSISNLSFISAGPTPPNPSELILREEFDMLIKRLFEIYDVVVIDT
DMR                                                                        VVIDT
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPVGLVTDGILILRKADIPLYVVRTDYSKKSAKRNINKLVKTIPKLCVLMNALKAINTYGYGGYGYGYGYGYYEGETEKE
PPVGLVTDGILILRKADIPLYVVRTDYSKKSAKRNINKLVKTIPKLCVLMNALKAINTYGYGGYGYGYGYGYYEGE    
PP                                                        YGYGGYGYGYGYGYY       
       810    
....:....|....
SIISKIKSLAGVKA


© 1998-2019