BYKdb

Annotate results for A0A099DJJ6

A0A099DJJ6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099DJJ6
DOMAINcd57/238TSASSGEGKSTTSSNLAVVYAQQGKRVLLVDCDMRRPTAHFTFRLSNGIGLSTVLAKKTT
VEKATHSTQVENLDLIAAGPIPPNPSELLSSKMMDRVLEELKTNYDIIILDAPPMMQVAD
TRLLARKVDGVVLVVGCDKSDRQMVVKAKEQLTLAEAHILGVVLNKREPQGSDDYYYYYA
YE
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDCDMR
SITEWalker B164/170IILDAPP
SITEY Cluster231/237YYYYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKFGKKKSKHIKYDKTGRELITVHKPKSPISEQYRTIRTNLEFTAVDDDLQTMVITSASSGEGKSTTSSNLAVVYAQQG
                                                        TSASSGEGKSTTSSNLAVVYAQQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLVDCDMRRPTAHFTFRLSNGIGLSTVLAKKTTVEKATHSTQVENLDLIAAGPIPPNPSELLSSKMMDRVLEELKTN
KRVLLVDCDMRRPTAHFTFRLSNGIGLSTVLAKKTTVEKATHSTQVENLDLIAAGPIPPNPSELLSSKMMDRVLEELKTN
   LLVDCDMR                                                                     
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
YDIIILDAPPMMQVADTRLLARKVDGVVLVVGCDKSDRQMVVKAKEQLTLAEAHILGVVLNKREPQGSDDYYYYYAYE
YDIIILDAPPMMQVADTRLLARKVDGVVLVVGCDKSDRQMVVKAKEQLTLAEAHILGVVLNKREPQGSDDYYYYYAYE
   IILDAPP                                                            YYYYYAY 
© 1998-2019