BYKdb

Annotate results for A0A099DKC0

A0A099DKC0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099DKC0
DOMAINcd51/231TSASPGEGKSTTASNLAIVYAQLGKKVLLMDCDMRKPTVHFTFQLAGQTGLSTVLAKRTT
FDRSVQMTKVPKLHLLAAGPIPPNPSELLASPMMKQLLDEVKEKYDLIILDAPPLMHVAD
SRLLASETDGTILVVGCDNSNRDLVLKAKEQLILSGAHMLGIVMNKRERAGKDAYYAYTY
E
SITEWalker A58/60GKS
SITEWalker A'78/85LLMDCDMR
SITEWalker B158/164IILDAPP
SITEY Cluster225/230YYAYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKRQDKHRDSGRSLITLANPKSPIAEQYRTIRTNLQFTALGATLQTIVVTSASPGEGKSTTASNLAIVYAQLGKKVLLM
                                                  TSASPGEGKSTTASNLAIVYAQLGKKVLLM
                                                         GKS                 LLM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DCDMRKPTVHFTFQLAGQTGLSTVLAKRTTFDRSVQMTKVPKLHLLAAGPIPPNPSELLASPMMKQLLDEVKEKYDLIIL
DCDMRKPTVHFTFQLAGQTGLSTVLAKRTTFDRSVQMTKVPKLHLLAAGPIPPNPSELLASPMMKQLLDEVKEKYDLIIL
DCDMR                                                                        IIL
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAPPLMHVADSRLLASETDGTILVVGCDNSNRDLVLKAKEQLILSGAHMLGIVMNKRERAGKDAYYAYTYE
DAPPLMHVADSRLLASETDGTILVVGCDNSNRDLVLKAKEQLILSGAHMLGIVMNKRERAGKDAYYAYTYE
DAPP                                                            YYAYTY 
© 1998-2019