BYKdb

Annotate results for A0A099HWI3

A0A099HWI3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099HWI3
DOMAINcd40/229TSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVHKMFSKPNALGLTDVLAGKK
ELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIM
DAGVLANYADGTILVVGAKDVETERAKISKERLEKVKANIIGAVLNKYIEKNGSYGYYSY
YYEQSDGSRV
SITEWalker A47/49GKT
SITEWalker A'68/75LLIDADLR
SITEWalker B148/154IFIDTPP
SITE-144/-147YYDY
SITEY Cluster214/221YGYYSYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MINITAFNDPKSPIAEAYRSIRTNIQFSRVDNEMKTIVVTSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVH
                                       TSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVH
                                              GKT                  LLIDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KMFSKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIMD
KMFSKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIMD
                                                                   IFIDTPP      
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
AGVLANYADGTILVVGAKDVETERAKISKERLEKVKANIIGAVLNKYIEKNGSYGYYSYYYEQSDGSRVSKKKKKKR
AGVLANYADGTILVVGAKDVETERAKISKERLEKVKANIIGAVLNKYIEKNGSYGYYSYYYEQSDGSRV        
                                                     YGYYSYYY                
© 1998-2019