BYKdb

Annotate results for A0A099I0N3

A0A099I0N3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099I0N3
DOMAINcd49/238TSSNPAEGKSSVASNLATVAIAKYEKVLLIDCDLRKPVQHKIFKVSNKLGISNLMKEKSE
IDLEIGGYFQKFKDNSTDGKLYVLTSGKSVPNPQEMLESERFKELIEKFREMFDYIIIDC
PPLNAVADAIPVSSIVDGTLFVVSAMDTDKSEAKNALTMLQRNGANVLGCVLTKVDITSK
SYYSYYGNYS
SITE-135/-137GKS
SITEWalker A'76/83LLIDCDLR
SITEWalker B164/170IIIDCPP
SITEY Cluster230/237YYSYYGNY
SITEWalker A56/58GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERKIAPKRSDPKKHTKKSQFDNMEVYRQLRTNIEYSSFNKDIQVICVTSSNPAEGKSSVASNLATVAIAKYEKVLLIDC
                                                TSSNPAEGKSSVASNLATVAIAKYEKVLLIDC
                                                       GKS                 LLIDC
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPVQHKIFKVSNKLGISNLMKEKSEIDLEIGGYFQKFKDNSTDGKLYVLTSGKSVPNPQEMLESERFKELIEKFREM
DLRKPVQHKIFKVSNKLGISNLMKEKSEIDLEIGGYFQKFKDNSTDGKLYVLTSGKSVPNPQEMLESERFKELIEKFREM
DLR                                                                             
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
FDYIIIDCPPLNAVADAIPVSSIVDGTLFVVSAMDTDKSEAKNALTMLQRNGANVLGCVLTKVDITSKSYYSYYGNYS
FDYIIIDCPPLNAVADAIPVSSIVDGTLFVVSAMDTDKSEAKNALTMLQRNGANVLGCVLTKVDITSKSYYSYYGNYS
   IIIDCPP                                                           YYSYYGNY 
© 1998-2019