BYKdb

Annotate results for A0A099RMM7

A0A099RMM7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A099RMM7
DOMAINtad15/269KDIDLAHLFDTFLNNRALIMGITGFFAALGIAYALLSTPVYLASAMIQIEPKNGLPSLTD
VVNTNPPVSPAQTEIALLKSRSVVGGAVQSLNLDIIIEPHHFPIIGGFMARRFEPKEEGE
LGWYPDGFESYAWGGEELKITQLDVPDQLHGEELVLEAAENNGFILRDPDDEVVVQGVVG
EPVETEEFRVNVEKLIARPGTTFTVIKNRTYNTTESYQQRLSAAEHGKQSGIVNVTLEDT
DPEEAVRVLEEVAQR
DOMAINcd550/737TGPSPAVGKSFVTTNLAAVIAQSGKRVLLVDADMRKGYLHKVMRADGEKGLSDILSGRIT
LFDAIQKTQLNNLHVISHGQLPPNPSELLMHENFARFVKEISTMYDLVIFDTPPILAVTD
AALVGSQAGTTLMVTRYGMNGIKEIEAAKRRLEQNGLLVKGVIFNAVIRKASTYGEYGYY
QYEYVSNK
SITEWalker A557/559GKS
SITEWalker A'577/584LLVDADMR
SITEWalker B657/663VIFDTPP
SITEY Cluster723/733YGEYGYYQYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTMPRPIYETKEDKDIDLAHLFDTFLNNRALIMGITGFFAALGIAYALLSTPVYLASAMIQIEPKNGLPSLTDVVNTNP
              KDIDLAHLFDTFLNNRALIMGITGFFAALGIAYALLSTPVYLASAMIQIEPKNGLPSLTDVVNTNP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVSPAQTEIALLKSRSVVGGAVQSLNLDIIIEPHHFPIIGGFMARRFEPKEEGELGWYPDGFESYAWGGEELKITQLDVP
PVSPAQTEIALLKSRSVVGGAVQSLNLDIIIEPHHFPIIGGFMARRFEPKEEGELGWYPDGFESYAWGGEELKITQLDVP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQLHGEELVLEAAENNGFILRDPDDEVVVQGVVGEPVETEEFRVNVEKLIARPGTTFTVIKNRTYNTTESYQQRLSAAEH
DQLHGEELVLEAAENNGFILRDPDDEVVVQGVVGEPVETEEFRVNVEKLIARPGTTFTVIKNRTYNTTESYQQRLSAAEH

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKQSGIVNVTLEDTDPEEAVRVLEEVAQRYVEQNVARNAAEATQSLEFLNEQVPAVRKQLEAAQTALNKYQTGSKTVDIT
GKQSGIVNVTLEDTDPEEAVRVLEEVAQR                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AETQSVLDRIVDLEAQISEQNLKRTEMERRFTRQHPNFQALINQINQLQTQKAELEKQIGTLPSTQQELLRLNRDVEVSS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGGLLAVAFVYVREALKRGVENPEDIERA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTPVYAAIPFSEKQAGLEKRLANFKRDKSTASYLLTVNDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
                                                                     TGPSPAVGKSF
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTTNLAAVIAQSGKRVLLVDADMRKGYLHKVMRADGEKGLSDILSGRITLFDAIQKTQLNNLHVISHGQLPPNPSELLMH
VTTNLAAVIAQSGKRVLLVDADMRKGYLHKVMRADGEKGLSDILSGRITLFDAIQKTQLNNLHVISHGQLPPNPSELLMH
                LLVDADMR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENFARFVKEISTMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGMNGIKEIEAAKRRLEQNGLLVKGVIFNAVIRKA
ENFARFVKEISTMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGMNGIKEIEAAKRRLEQNGLLVKGVIFNAVIRKA
                VIFDTPP                                                         
       730       
....:....|....:..
STYGEYGYYQYEYVSNK
STYGEYGYYQYEYVSNK
  YGEYGYYQYEY    

© 1998-2019