BYKdb

Annotate results for A0A099SBU7

A0A099SBU7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099SBU7
DOMAINcd42/230TSSGPNEGKSTTACNLAIVMAQTGSKTILIDCDQRKPSIHKVFGLSNECGLSNILADEVE
FKDAVYKTQIENLEMLPSGTKPPNPSEILSSEKMKRFLQRLKEKYDSIIIDTPPIVAVTD
AQLLSTYVDGCILVVASGQTDRGAAMKAKGLLDKVGAKILGVVLNKVDTSNKGYYGARYY
NYYSEDYEC
SITEWalker A49/51GKS
SITEWalker A'69/76ILIDCDQR
SITEWalker B149/155IIIDTPP
SITEY Cluster215/228YYGARYYNYYSEDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNESYLISIKNPMNPISEAYRTLRTNIKFSSFDKEIKSLVITSSGPNEGKSTTACNLAIVMAQTGSKTILIDCDQRKPSI
                                         TSSGPNEGKSTTACNLAIVMAQTGSKTILIDCDQRKPSI
                                                GKS                 ILIDCDQR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKVFGLSNECGLSNILADEVEFKDAVYKTQIENLEMLPSGTKPPNPSEILSSEKMKRFLQRLKEKYDSIIIDTPPIVAVT
HKVFGLSNECGLSNILADEVEFKDAVYKTQIENLEMLPSGTKPPNPSEILSSEKMKRFLQRLKEKYDSIIIDTPPIVAVT
                                                                    IIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQLLSTYVDGCILVVASGQTDRGAAMKAKGLLDKVGAKILGVVLNKVDTSNKGYYGARYYNYYSEDYECKKRKRLFNIG
DAQLLSTYVDGCILVVASGQTDRGAAMKAKGLLDKVGAKILGVVLNKVDTSNKGYYGARYYNYYSEDYEC          
                                                      YYGARYYNYYSEDY            
     
....:
VRHFG


© 1998-2019