BYKdb

Annotate results for A0A099SCK1

A0A099SCK1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099SCK1
DOMAINcd42/229TSSGPGEGKSTTASNLAAVMAQAGNKTVIIDCDQRKPRLHKVFGLSNERGISDILAKEIK
FDDAVQSTEQENLDIITSGTKPPNPAELLASATMKEFLESLKEKYDTIIIDTPPIVAVTD
AQLLSRHADGCILVIASQQADRDAAIKAKELLEKVDANMLGVVLNKVDTTHKGYYGAYYS
YYAEEDGS
SITEWalker A49/51GKS
SITEWalker A'69/76VIIDCDQR
SITEWalker B149/155IIIDTPP
SITEY Cluster215/223YYGAYYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKVSELITIRKPLSPISESYRTLRTNIKFSSVDKEIRVIVVTSSGPGEGKSTTASNLAAVMAQAGNKTVIIDCDQRKPRL
                                         TSSGPGEGKSTTASNLAAVMAQAGNKTVIIDCDQRKPRL
                                                GKS                 VIIDCDQR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKVFGLSNERGISDILAKEIKFDDAVQSTEQENLDIITSGTKPPNPAELLASATMKEFLESLKEKYDTIIIDTPPIVAVT
HKVFGLSNERGISDILAKEIKFDDAVQSTEQENLDIITSGTKPPNPAELLASATMKEFLESLKEKYDTIIIDTPPIVAVT
                                                                    IIIDTPP     
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
DAQLLSRHADGCILVIASQQADRDAAIKAKELLEKVDANMLGVVLNKVDTTHKGYYGAYYSYYAEEDGSDKNK
DAQLLSRHADGCILVIASQQADRDAAIKAKELLEKVDANMLGVVLNKVDTTHKGYYGAYYSYYAEEDGS    
                                                      YYGAYYSYY          
© 1998-2019