BYKdb

Annotate results for A0A099SE90

A0A099SE90 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099SE90
DOMAINcd41/229TSSGPREGKSTTVANLAVSIAQSGKTVLVIDADLRNPTQHKLFELGNFEGLSTFLVQDEQ
NKDFIKETEVPGVKVLTGGPIPPNPAELVGSQRMKRLIEEVSEQFDMVLIDTPPIIAVTD
AAVLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADMKTSEYYYYYYY
HGSDDHKKK
SITE-64/-66GKT
SITEWalker A'68/75LVIDADLR
SITEWalker B148/154VLIDTPP
SITEY Cluster214/220YYYYYYY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFSLITHEQTKSPISEAYRTLRTNVQFTGVDTKTKKIMITSSGPREGKSTTVANLAVSIAQSGKTVLVIDADLRNPTQH
                                        TSSGPREGKSTTVANLAVSIAQSGKTVLVIDADLRNPTQH
                                               GKS                 LVIDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLFELGNFEGLSTFLVQDEQNKDFIKETEVPGVKVLTGGPIPPNPAELVGSQRMKRLIEEVSEQFDMVLIDTPPIIAVTD
KLFELGNFEGLSTFLVQDEQNKDFIKETEVPGVKVLTGGPIPPNPAELVGSQRMKRLIEEVSEQFDMVLIDTPPIIAVTD
                                                                   VLIDTPP      
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
AAVLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADMKTSEYYYYYYYHGSDDHKKKKRS
AAVLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADMKTSEYYYYYYYHGSDDHKKK   
                                                     YYYYYYY            
© 1998-2019