BYKdb

Annotate results for A0A099VVN6

A0A099VVN6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099VVN6
DOMAINcd38/216TSSLSSEGKSSIAIGIARSFAEAGKKVLLIDSDFRRPSVHKKLGLSNAVGFCDVLKEDYT
LTECMKDIGVQGLDILTSGLVEDSPSILFDATTLKKFILEVKKEYDLVIIDTPPVLLVPE
VKTILNHSDATLLVVKYDEVRKEEVERTYRVLNQVSATCLGIVFNRVKVKVKDRYRYYY
SITEWalker A45/47GKS
SITEWalker A'65/72LLIDSDFR
SITEWalker B145/151VIIDTPP
SITEY Cluster212/216YRYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTKEMLNENLFFQEQMAHIRTTIELSGQRDTQAISVTSSLSSEGKSSIAIGIARSFAEAGKKVLLIDSDFRRPSVHKKL
                                     TSSLSSEGKSSIAIGIARSFAEAGKKVLLIDSDFRRPSVHKKL
                                            GKS                 LLIDSDFR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLSNAVGFCDVLKEDYTLTECMKDIGVQGLDILTSGLVEDSPSILFDATTLKKFILEVKKEYDLVIIDTPPVLLVPEVKT
GLSNAVGFCDVLKEDYTLTECMKDIGVQGLDILTSGLVEDSPSILFDATTLKKFILEVKKEYDLVIIDTPPVLLVPEVKT
                                                                VIIDTPP         
       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
ILNHSDATLLVVKYDEVRKEEVERTYRVLNQVSATCLGIVFNRVKVKVKDRYRYYY
ILNHSDATLLVVKYDEVRKEEVERTYRVLNQVSATCLGIVFNRVKVKVKDRYRYYY
                                                   YRYYY
© 1998-2019