BYKdb

Annotate results for A0A099VYT7

A0A099VYT7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099VYT7
DOMAINcd46/227TSCRQGEGKSSLIANLAMFMSKSGKRVLLIDGDLRLPTIHRIFKLKNYVGLSDLLKDDQF
HRYEGIQKIDDYLDVMASGASPYNPSELLSDSLLPEILKEYETVYDFIFIDAPPIGLSDT
IITANYCDATILVLENGKTTKTQLKECIEKCKMQNIDVLGIIRNKVKRRRHESSYYYDYV
KK
SITE-182/-184GKT
SITEWalker A'73/80LLIDGDLR
SITEWalker B153/159IFIDAPP
SITE-146/-150YETVY
SITEY Cluster220/224YYYDY
SITEWalker A53/55GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVIQKKAKQRTLITNEKGTIPEQFRNIRASIQYVADKKKIKTIMATSCRQGEGKSSLIANLAMFMSKSGKRVLLIDGDLR
                                             TSCRQGEGKSSLIANLAMFMSKSGKRVLLIDGDLR
                                                    GKS                 LLIDGDLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPTIHRIFKLKNYVGLSDLLKDDQFHRYEGIQKIDDYLDVMASGASPYNPSELLSDSLLPEILKEYETVYDFIFIDAPPI
LPTIHRIFKLKNYVGLSDLLKDDQFHRYEGIQKIDDYLDVMASGASPYNPSELLSDSLLPEILKEYETVYDFIFIDAPPI
                                                                        IFIDAPP 
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
GLSDTIITANYCDATILVLENGKTTKTQLKECIEKCKMQNIDVLGIIRNKVKRRRHESSYYYDYVKK
GLSDTIITANYCDATILVLENGKTTKTQLKECIEKCKMQNIDVLGIIRNKVKRRRHESSYYYDYVKK
                                                           YYYDY   
© 1998-2019