BYKdb

Annotate results for A0A099W967

A0A099W967 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099W967
DOMAINcd61/238TSSEPDSGKSIICANLAVVFAQQGKKTLLIDADLRKPTVKKIFPGAASHGLTGILTNKIT
VSEAICETDVEDLYVLPAGIVPPNPSELLGSEKMKQVYAELYELFDQIIFDTPPIQLVVD
AQLLCSFVDGSILLVRSDHSSRENSKKALEKLRSGSAHVIGSIFNNQKMKMEGYYYAN
SITEWalker A68/70GKS
SITEWalker A'88/95LLIDADLR
SITEWalker B168/174IIFDTPP
SITE-158/-162YAELY
SITEY Cluster234/236YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKSKKKSKAETRHRRQKSTEPQKLVAKLSPKSPHSELFRSIRTNIEFSSVDKVMKSILITSSEPDSGKSIICANLAVVF
                                                            TSSEPDSGKSIICANLAVVF
                                                                   GKS          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQQGKKTLLIDADLRKPTVKKIFPGAASHGLTGILTNKITVSEAICETDVEDLYVLPAGIVPPNPSELLGSEKMKQVYAE
AQQGKKTLLIDADLRKPTVKKIFPGAASHGLTGILTNKITVSEAICETDVEDLYVLPAGIVPPNPSELLGSEKMKQVYAE
       LLIDADLR                                                                 
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
LYELFDQIIFDTPPIQLVVDAQLLCSFVDGSILLVRSDHSSRENSKKALEKLRSGSAHVIGSIFNNQKMKMEGYYYAN
LYELFDQIIFDTPPIQLVVDAQLLCSFVDGSILLVRSDHSSRENSKKALEKLRSGSAHVIGSIFNNQKMKMEGYYYAN
       IIFDTPP                                                           YYY  
© 1998-2019