BYKdb

Annotate results for A0A099WC17

A0A099WC17 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WC17
DOMAINcd50/227TSSEPDSGKSLICANLAVVFAQQGKKTLLIDGDLRKPTVKKIFPEAVSHGLTGILTNRVT
IDEAIRETEVENLYVLPAGVVPPNPSELLGSEKMKQVYAELYEIFDQIIFDTPPIQLVVD
AQLLCSLVDGSILLVRSNHSSKENSKKALQKLQTANAHVIGSIFNNNKMKMDGYYYAD
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDGDLR
SITEWalker B157/163IIFDTPP
SITE-147/-151YAELY
SITEY Cluster223/225YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSHRRQKTDEPQKLIAKINPKSPHSELFRSIRTNIEFSSVDKPMRSILITSSEPDSGKSLICANLAVVFAQQGKKTLLID
                                                 TSSEPDSGKSLICANLAVVFAQQGKKTLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDLRKPTVKKIFPEAVSHGLTGILTNRVTIDEAIRETEVENLYVLPAGVVPPNPSELLGSEKMKQVYAELYEIFDQIIFD
GDLRKPTVKKIFPEAVSHGLTGILTNRVTIDEAIRETEVENLYVLPAGVVPPNPSELLGSEKMKQVYAELYEIFDQIIFD
GDLR                                                                        IIFD
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
TPPIQLVVDAQLLCSLVDGSILLVRSNHSSKENSKKALQKLQTANAHVIGSIFNNNKMKMDGYYYAD
TPPIQLVVDAQLLCSLVDGSILLVRSNHSSKENSKKALQKLQTANAHVIGSIFNNNKMKMDGYYYAD
TPP                                                           YYY  
© 1998-2019