BYKdb

Annotate results for A0A099WCP7

A0A099WCP7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WCP7
DOMAINcd46/226TSCRQGEGKSSAIVNLAYFMAKNNKKVLVIDSDLRLPTIHKPFQLQNFSGLTDFLNELMD
EKETIQQVAENLDVVTSGPLPYNPTELLSKKRFKTFIDTQRVDYDFIFVDAPPSGLADSK
IIGSVCDSTIIVVENGKTTKNQLKTCIDTCKMQNIDIIGVIRNKIRKKKHDSNYYYNYVK
E
SITE-181/-183GKT
SITEWalker A'73/80LVIDSDLR
SITEWalker B152/158IFVDAPP
SITEY Cluster219/223YYYNY
SITEWalker A53/55GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVIKKQYSERQLIKKEKGVIPEQIRNIRTNIQYLADKRNLKVIMVTSCRQGEGKSSAIVNLAYFMAKNNKKVLVIDSDLR
                                             TSCRQGEGKSSAIVNLAYFMAKNNKKVLVIDSDLR
                                                    GKS                 LVIDSDLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPTIHKPFQLQNFSGLTDFLNELMDEKETIQQVAENLDVVTSGPLPYNPTELLSKKRFKTFIDTQRVDYDFIFVDAPPSG
LPTIHKPFQLQNFSGLTDFLNELMDEKETIQQVAENLDVVTSGPLPYNPTELLSKKRFKTFIDTQRVDYDFIFVDAPPSG
                                                                       IFVDAPP  
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
LADSKIIGSVCDSTIIVVENGKTTKNQLKTCIDTCKMQNIDIIGVIRNKIRKKKHDSNYYYNYVKE
LADSKIIGSVCDSTIIVVENGKTTKNQLKTCIDTCKMQNIDIIGVIRNKIRKKKHDSNYYYNYVKE
                                                          YYYNY   
© 1998-2019